DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kif3C and KIF19

DIOPT Version :9

Sequence 1:NP_651939.4 Gene:Kif3C / 43820 FlyBaseID:FBgn0039925 Length:649 Species:Drosophila melanogaster
Sequence 2:XP_016879639.1 Gene:KIF19 / 124602 HGNCID:26735 Length:1012 Species:Homo sapiens


Alignment Length:603 Identity:184/603 - (30%)
Similarity:288/603 - (47%) Gaps:103/603 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ENIKVVVRCRPMNQTEKERNCQNIV-EINEFAVSVTNP--------SARISQQKKFIFDSVYNMK 58
            :.:.|.:|.||::..|.|.....|. :::|..|.:.:|        .|..|::|.::||..::..
Human    10 QQLMVALRVRPISVAELEEGATLIAHKVDEQMVVLMDPMEDPDDILRAHRSREKSYLFDVAFDFT 74

  Fly    59 TDTEVIYDEMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQGDENFSNSTGIIPKCFDHIFERIS 123
            ...|::|.....||:|..|.|||.|:||||.||||||:||.|.:   ...||..:..:.:|..|.
Human    75 ATQEMVYQATTKSLIEGVISGYNATVFAYGPTGCGKTYTMLGTD---QEPGIYVQTLNDLFRAIE 136

  Fly   124 MTTN-VRYLALVTYLEIYNERIRDLLNKNENTNVINHFLKELPGIG-----------VSVPTLTT 176
            .|:| :.|...::|||||||.||||||               |.:|           :.|..:|.
Human   137 ETSNDMEYEVSMSYLEIYNEMIRDLLN---------------PSLGYLELREDSKGVIQVAGITE 186

  Fly   177 QPVVNANQCYDWLHFGNKNRVTAATLMNKNSSRSHTIFTITLEQSPFLNSIGSDAFGGICRGKLS 241
            ...:||.:....|..||:.|....|..|:.|||||.:..:|:.|...:.:|..:    :.:|:|.
Human   187 VSTINAKEIMQLLMKGNRQRTQEPTAANQTSSRSHAVLQVTVRQRSRVKNILQE----VRQGRLF 247

  Fly   242 LVDLAGSERQRKTGAQGDRLKEASQINLSLSALGNVISSLVD-GKAKHVPFRDSKLTRLL----- 300
            ::|||||||..:|..:|.|:||.:.||.||.||||.|::|.| |..|::.:|||||||||     
Human   248 MIDLAGSERASQTQNRGQRMKEGAHINRSLLALGNCINALSDKGSNKYINYRDSKLTRLLKVPAT 312

  Fly   301 --------QDSLGGNTKTLMISCISPTDIHYDETISTLRYASRAKNISNKPKINEDPKDARLRQY 357
                    :||||||::|:||:.|||....::|:.:||.||.|||||..:.|.|.......:.||
Human   313 AGPGHWAPRDSLGGNSRTVMIAHISPASSAFEESRNTLTYAGRAKNIKTRVKQNLLNVSYHIAQY 377

  Fly   358 QNEILYLKRMLQESQQIINKNNDPNKIIKSPLKIIQHTNMNSTKNVQIIDLG--RNCKASFKTNN 420
            .:.|..|:..:|..::                ||.:.|.....:..|  |.|  |:.:|..:.::
Human   378 TSIIADLRGEIQRLKR----------------KIDEQTGRGQARGRQ--DRGDIRHIQAEVQLHS 424

  Fly   421 SILTKPNFPLIQSKEEVQLQARSRIDLIKRSLIGGERIHDFELKEKHMARKYAAQRHLSAIA--- 482
            ....|..  :.|.:|::....:.::|:.:|.|         ||:.:.|..:....|||..||   
Human   425 GQGEKAG--MGQLREQLASAFQEQMDVRRRLL---------ELENRAMEVQIDTSRHLLTIAGWK 478

  Fly   483 -----IAL-----SRVKCEDRDLLQGHYATITQEIDI-KNDYIRKCKEKIKMLEMEVSDLNSEFQ 536
                 .||     .|.:|..:|..:....|...:.|| :...:...:|.|..|..|...|..: :
Human   479 HEKSRRALKWREEQRKECYAKDDSEKDSDTGDDQPDILEPPEVAAARESIAALVDEQKQLRKQ-K 542

  Fly   537 LDREDYLDEIRNLGRQVK 554
            |..|....|:|..||:::
Human   543 LALEQRCRELRARGRRLE 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kif3CNP_651939.4 Motor_domain 3..339 CDD:277568 134/370 (36%)
Kinesin 10..339 CDD:278646 133/363 (37%)
KIF19XP_016879639.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.