DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kif3C and Kif1c

DIOPT Version :9

Sequence 1:NP_651939.4 Gene:Kif3C / 43820 FlyBaseID:FBgn0039925 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_665884.2 Gene:Kif1c / 113886 RGDID:70928 Length:1100 Species:Rattus norvegicus


Alignment Length:382 Identity:153/382 - (40%)
Similarity:217/382 - (56%) Gaps:26/382 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NIKVVVRCRPMNQTEKERNCQNIVEINEFAVSVTNPSARISQQKKFIFDSVYNMKTDTE------ 62
            ::||.||.||.|..|..::.:.:|.:.....|:.||.......|.|.||..|...|..|      
  Rat     5 SVKVAVRVRPFNARETSQDAKCVVSMQGNTTSIINPKQSKDAPKSFTFDYSYWSHTSVEDPQFAS 69

  Fly    63 --VIYDEMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQGDENFSNSTGIIPKCFDHIFERISM- 124
              .:|.::...::....||||..||||||||.||::||.|.:. ....||:|:..:.:|.|::: 
  Rat    70 QQQVYRDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGRQE-PGQQGIVPQLCEDLFSRVNVN 133

  Fly   125 -TTNVRYLALVTYLEIYNERIRDLLNKNENTNVINHFLKELPGIGVSVPTLTTQPVVNANQCYDW 188
             :..:.|...|:|:|||.||:|||||.....::   .::|.|.:|..|..|:...|.:.....|.
  Rat   134 QSAQLSYSVEVSYMEIYCERVRDLLNPKSRGSL---RVREHPILGPYVQDLSKLAVTSYADIADL 195

  Fly   189 LHFGNKNRVTAATLMNKNSSRSHTIFTITLEQSPF--LNSIGSDAFGGICRGKLSLVDLAGSERQ 251
            :..|||.|..|||.||:.|||||.:|||...|...  |..:.|:..     .|:||||||||||.
  Rat   196 MDCGNKARTVAATNMNETSSRSHAVFTIVFTQRSHDQLTGLDSEKV-----SKISLVDLAGSERA 255

  Fly   252 RKTGAQGDRLKEASQINLSLSALGNVISSLVD-----GKAKHVPFRDSKLTRLLQDSLGGNTKTL 311
            ..:||:|.||||.:.||.||:.||.|||:|.|     .|:..:|:|||.||.||:::||||::|.
  Rat   256 DSSGARGMRLKEGANINKSLTTLGKVISALADLQSKKRKSDFIPYRDSVLTWLLKENLGGNSRTA 320

  Fly   312 MISCISPTDIHYDETISTLRYASRAKNISNKPKINEDPKDARLRQYQNEILYLKRML 368
            ||:.:||.||:|:||:||||||.|.|.|.....|||||....:|:.|.|:..|:.:|
  Rat   321 MIAALSPADINYEETLSTLRYADRTKQIRCNAVINEDPNARLIRELQEEVARLRELL 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kif3CNP_651939.4 Motor_domain 3..339 CDD:277568 142/351 (40%)
Kinesin 10..339 CDD:278646 139/345 (40%)
Kif1cNP_665884.2 KISc_KIF1A_KIF1B 4..355 CDD:276816 143/358 (40%)
Kinesin_assoc 352..522 CDD:406567 10/26 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..435
FHA 499..599 CDD:238017
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 900..924
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 949..1100
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.