DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pho and ZNF682

DIOPT Version :9

Sequence 1:NP_524630.1 Gene:pho / 43819 FlyBaseID:FBgn0002521 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_016882944.1 Gene:ZNF682 / 91120 HGNCID:28857 Length:504 Species:Homo sapiens


Alignment Length:346 Identity:85/346 - (24%)
Similarity:149/346 - (43%) Gaps:58/346 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 QKLVHIKTMEGEFSVTMWASGISDDEYSGSDQIVGASDLLKGKEEFGIDGFTSQQNKEYQKMESK 214
            |:|:..:.:..|||:..|      :..:.:.|.:....:|:........|.|..:.:...::|.:
Human     7 QELLTFRDVTIEFSLEEW------EFLNPAQQSLYRKVMLENYRNLVSLGLTVSKPELISRLEQR 65

  Fly   215 -----FTNAQTLEMPHPISSVQIMDHLIKERGNLSQENNISERILSK-TTLSFEEPILLPDSSSI 273
                 ....:|:..| |..|....:.|:.|:   ..:::..:.||.: .:...|:..|..|..::
Human    66 QEPWNVKRHETIAKP-PAMSSHYTEDLLPEQ---CMQDSFQKVILRRYGSCGLEDLHLRKDGENV 126

  Fly   274 ELVNETAAMTINNHRTLSNHTGNTGDLHALPSSV-PFRIGLHEGQVNDCLSTISQST--HQDNTD 335
            ....:...:          :.|....|..|||.: |:         |.|:...|:|:  :::|..
Human   127 GECKDQKEI----------YNGLNQCLSTLPSKIFPY---------NKCVKVFSKSSNLNRENIR 172

  Fly   336 ST--------GCGEMNLSEVTVSY-----TNDKKIACPHKGCNKHFRDSSAMRKHLHTH-GPRVH 386
            .|        .||::..|...:||     |.:|...|  :.|.|.|:..|.:.||...| |.:.:
Human   173 HTTEKLFKCMQCGKVFKSHSGLSYHKIIHTEEKLCIC--EECGKTFKWFSYLTKHKRIHTGEKPY 235

  Fly   387 VCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPFVCPFDAC 451
            .|.||||||...|.|.:|:.:||||||::|  |.|||.|........|.:||||::|:.|  :.|
Human   236 KCEECGKAFNWCSSLTKHKRIHTGEKPYKC--EECGKAFHWCSPFVRHKKIHTGEKPYTC--EDC 296

  Fly   452 NKKFAQSTNLKSHILTHAKAK 472
            .:.|.:.::|..|...|...|
Human   297 GRAFNRHSHLTKHKTIHTGKK 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
phoNP_524630.1 Transpos_assoc <342..382 CDD:290671 13/45 (29%)
C2H2 Zn finger 359..381 CDD:275368 7/21 (33%)
COG5048 <386..515 CDD:227381 35/87 (40%)
zf-C2H2 386..408 CDD:278523 10/21 (48%)
C2H2 Zn finger 388..408 CDD:275368 10/19 (53%)
zf-H2C2_2 401..426 CDD:290200 13/24 (54%)
C2H2 Zn finger 416..438 CDD:275368 7/21 (33%)
zf-H2C2_2 430..457 CDD:290200 9/26 (35%)
C2H2 Zn finger 446..468 CDD:275368 5/21 (24%)
ZNF682XP_016882944.1 KRAB 10..70 CDD:214630 9/65 (14%)
KRAB 10..49 CDD:279668 6/44 (14%)
C2H2 Zn finger 153..173 CDD:275368 5/28 (18%)
C2H2 Zn finger 181..201 CDD:275368 5/19 (26%)
C2H2 Zn finger 209..229 CDD:275368 7/21 (33%)
zf-H2C2_2 221..245 CDD:290200 10/23 (43%)
C2H2 Zn finger 237..257 CDD:275368 10/19 (53%)
COG5048 <245..451 CDD:227381 28/77 (36%)
zf-H2C2_2 249..273 CDD:290200 13/25 (52%)
C2H2 Zn finger 265..285 CDD:275368 7/21 (33%)
zf-H2C2_2 280..302 CDD:290200 9/23 (39%)
C2H2 Zn finger 293..313 CDD:275368 5/21 (24%)
zf-H2C2_2 305..330 CDD:290200 4/13 (31%)
C2H2 Zn finger 321..341 CDD:275368
zf-H2C2_2 334..358 CDD:290200
C2H2 Zn finger 349..369 CDD:275368
zf-H2C2_2 362..386 CDD:290200
C2H2 Zn finger 377..397 CDD:275368
zf-H2C2_2 389..413 CDD:290200
C2H2 Zn finger 405..425 CDD:275368
zf-H2C2_2 418..442 CDD:290200
C2H2 Zn finger 433..453 CDD:275368
zf-H2C2_2 445..470 CDD:290200
C2H2 Zn finger 461..480 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.