DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pho and PZF1

DIOPT Version :9

Sequence 1:NP_524630.1 Gene:pho / 43819 FlyBaseID:FBgn0002521 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_015512.1 Gene:PZF1 / 856316 SGDID:S000006390 Length:429 Species:Saccharomyces cerevisiae


Alignment Length:196 Identity:59/196 - (30%)
Similarity:94/196 - (47%) Gaps:32/196 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 ISQSTHQDNTDSTGCGEMNLSEVTVSYTN-DKKIACPHKGCNKHFRDSSAMRKH-LHTH-GPRVH 386
            ||:|...::.:|       |:....|.:| .|...|.:.||:|.|...|.:.:| |..| |.|..
Yeast    23 ISRSESSESLNS-------LTSTRSSSSNRPKTYFCDYDGCDKAFTRPSILTEHQLSVHQGLRAF 80

  Fly   387 VCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPFVCPFDAC 451
            .|.:|.|:||:.|.|:||...|:..|||||::  |||..:....|:.|...||  :.|:||.:.|
Yeast    81 QCDKCAKSFVKKSHLERHLYTHSDTKPFQCSY--CGKGVTTRQQLKRHEVTHT--KSFICPEEGC 141

  Fly   452 NKKFAQSTNLKSHILT-HAKAKRNTSISGKSGCSNAESNSQSEDTSANYVKVELQDSVTENHVPF 515
            |.:|.:...|::|||: |..         |..|.:...:.|.        ...|::.::::|.|.
Yeast   142 NLRFYKHPQLRAHILSVHLH---------KLTCPHCNKSFQR--------PYRLRNHISKHHDPE 189

  Fly   516 V 516
            |
Yeast   190 V 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
phoNP_524630.1 Transpos_assoc <342..382 CDD:290671 13/42 (31%)
C2H2 Zn finger 359..381 CDD:275368 8/22 (36%)
COG5048 <386..515 CDD:227381 38/129 (29%)
zf-C2H2 386..408 CDD:278523 9/21 (43%)
C2H2 Zn finger 388..408 CDD:275368 9/19 (47%)
zf-H2C2_2 401..426 CDD:290200 12/24 (50%)
C2H2 Zn finger 416..438 CDD:275368 6/21 (29%)
zf-H2C2_2 430..457 CDD:290200 10/26 (38%)
C2H2 Zn finger 446..468 CDD:275368 9/22 (41%)
PZF1NP_015512.1 COG5048 46..427 CDD:227381 52/166 (31%)
C2H2 Zn finger 54..74 CDD:275368 7/19 (37%)
C2H2 Zn finger 82..102 CDD:275368 9/19 (47%)
C2H2 Zn finger 110..130 CDD:275368 6/21 (29%)
C2H2 Zn finger 136..155 CDD:275368 6/18 (33%)
C2H2 Zn finger 165..185 CDD:275368 3/27 (11%)
C2H2 Zn finger 196..216 CDD:275368
C2H2 Zn finger 224..244 CDD:275368
C2H2 Zn finger 255..277 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.