DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment pho and Zfp787

DIOPT Version :9

Sequence 1:	NP_524630.1	Gene:	pho / 43819	FlyBaseID:	FBgn0002521	Length:	520	Species:	Drosophila melanogaster
Sequence 2:	NP_001013030.1	Gene:	Zfp787 / 67109	MGIID:	1914359	Length:	381	Species:	Mus musculus

Alignment Length:	110	Identity:	50/110 - (45%)
Similarity:	67/110 - (60%)	Gaps:	5/110 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly   364 CNKHFRDSSAMRKHLHTH-GPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSL 427
            |.|.|...|.:.:|..|| |.|.:.|.:|||.|.:||.|.:|:.:||||||:.|:  .||||||.
Mouse    71 CGKSFSHWSKLTRHQRTHTGERPNACTDCGKTFSQSSHLVQHRRIHTGEKPYACS--ECGKRFSW 133

  Fly   428 DFNLRTHVRIHTGDRPFVCPFDACNKKFAQSTNLKSHILTHAKAK 472
            ..||..|.|||||::|:.||  .|.:.|.||.:|..|..:|:..|
Mouse   134 SSNLMQHQRIHTGEKPYTCP--DCGRSFTQSKSLAKHRRSHSGLK 176

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
pho	NP_524630.1	Transpos_assoc	<342..382	CDD:290671	7/18 (39%)
		C2H2 Zn finger	359..381	CDD:275368	5/16 (31%)
		COG5048	<386..515	CDD:227381	41/87 (47%)
		zf-C2H2	386..408	CDD:278523	9/21 (43%)
		C2H2 Zn finger	388..408	CDD:275368	9/19 (47%)
		zf-H2C2_2	401..426	CDD:290200	13/24 (54%)
		C2H2 Zn finger	416..438	CDD:275368	11/21 (52%)
		zf-H2C2_2	430..457	CDD:290200	13/26 (50%)
		C2H2 Zn finger	446..468	CDD:275368	8/21 (38%)
Zfp787	NP_001013030.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..65
		zf-C2H2	66..88	CDD:395048	5/16 (31%)
		C2H2 Zn finger	68..88	CDD:275368	5/16 (31%)
		COG5048	<93..200	CDD:227381	41/88 (47%)
		C2H2 Zn finger	96..116	CDD:275368	9/19 (47%)
		C2H2 Zn finger	124..144	CDD:275368	11/21 (52%)
		C2H2 Zn finger	152..172	CDD:275368	8/21 (38%)
		C2H2 Zn finger	180..200	CDD:275368
		C2H2 Zn finger	282..302	CDD:275368
		C2H2 Zn finger	319..339	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910