DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pho and SNAI1

DIOPT Version :10

Sequence 1:NP_524630.1 Gene:pho / 43819 FlyBaseID:FBgn0002521 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_005976.2 Gene:SNAI1 / 6615 HGNCID:11128 Length:264 Species:Homo sapiens


Alignment Length:285 Identity:70/285 - (24%)
Similarity:112/285 - (39%) Gaps:65/285 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 LIKERGNLSQENNISERILSKTTLSFEEPI----LLPDSSSIELVNETAAM-------------- 282
            |:::..:.:::.|.||...|....:|::|.    ||......|::|.||::              
Human     6 LVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQ 70

  Fly   283 -------------TINNHRTLSNHTGNTGDLHALPSSVPFRIGLHEGQVNDCLSTISQSTHQDNT 334
                         .:....:||:.....|   :.|.|.|       .......|:.|.|:.:...
Human    71 PIAWASLRLQESPRVAELTSLSDEDSGKG---SQPPSPP-------SPAPSSFSSTSVSSLEAEA 125

  Fly   335 DST--GCGEMNLSEVTVSYTND----KKIACPHKGCNKHFRDSSAMRKHLHTHGPRVHVCAECGK 393
            .:.  |.|::......:|...|    |...|  |.|||.:....|::.|:.:| ....||..|||
Human   126 YAAFPGLGQVPKQLAQLSEAKDLQARKAFNC--KYCNKEYLSLGALKMHIRSH-TLPCVCGTCGK 187

  Fly   394 AFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPFVCPFDACNKKFAQS 458
            ||.....|:.|...|||||||.|..  |.:.|:...|||.|::.|:..:.:.|  .||.:.|::.
Human   188 AFSRPWLLQGHVRTHTGEKPFSCPH--CSRAFADRSNLRAHLQTHSDVKKYQC--QACARTFSRM 248

  Fly   459 TNLKSHILTHAKAKRNTSISGKSGC 483
            :.|..|           ..||.|||
Human   249 SLLHKH-----------QESGCSGC 262

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
phoNP_524630.1 C2H2 Zn finger 359..381 CDD:275368 7/21 (33%)
COG5048 <386..515 CDD:227381 35/98 (36%)
C2H2 Zn finger 388..408 CDD:275368 8/19 (42%)
zf-H2C2_2 401..426 CDD:463886 11/24 (46%)
C2H2 Zn finger 416..438 CDD:275368 7/21 (33%)
zf-H2C2_2 430..457 CDD:463886 9/26 (35%)
C2H2 Zn finger 446..468 CDD:275368 6/21 (29%)
SNAI1NP_005976.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 5/20 (25%)
SNAG domain. /evidence=ECO:0000305|PubMed:20389281, ECO:0000305|PubMed:21300290 1..20 2/13 (15%)