DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pho and znf367

DIOPT Version :9

Sequence 1:NP_524630.1 Gene:pho / 43819 FlyBaseID:FBgn0002521 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001017726.2 Gene:znf367 / 550421 ZFINID:ZDB-GENE-050417-231 Length:316 Species:Danio rerio


Alignment Length:183 Identity:51/183 - (27%)
Similarity:74/183 - (40%) Gaps:39/183 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 GEMNLSEVTVSYTNDKKIACPHK-----------GCNKHFRDSSAMRKHLHTHGPRVHV------ 387
            || |...||:|..:....|.|.:           .|.:|.:|.      :....||...      
Zfish    55 GE-NAHNVTLSPGSGSGAASPTRTSSSPAEADPLSCPEHLKDG------IRRGRPRADTVRELIN 112

  Fly   388 ----------CAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDR 442
                      |..|.:.|.....|:.|:..||||:|:.|.:..|||.|.....|:||.|:|||::
Zfish   113 EGENSTSRIRCNICNRVFPREKSLQAHKRTHTGERPYLCDYPDCGKAFVQSGQLKTHQRLHTGEK 177

  Fly   443 PFVCPFDACNKKFAQSTNLKSHILTH--AKAKRNTSISGKSGCSNAESNSQSE 493
            ||||...||..:|   |:...|...|  |:.||.....|......|::.:.:|
Zfish   178 PFVCSEKACGSRF---THANRHCAKHPYARLKREEPTGGPGKSQGADNKAVAE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
phoNP_524630.1 Transpos_assoc <342..382 CDD:290671 9/50 (18%)
C2H2 Zn finger 359..381 CDD:275368 4/32 (13%)
COG5048 <386..515 CDD:227381 38/126 (30%)
zf-C2H2 386..408 CDD:278523 5/37 (14%)
C2H2 Zn finger 388..408 CDD:275368 5/19 (26%)
zf-H2C2_2 401..426 CDD:290200 11/24 (46%)
C2H2 Zn finger 416..438 CDD:275368 9/21 (43%)
zf-H2C2_2 430..457 CDD:290200 14/26 (54%)
C2H2 Zn finger 446..468 CDD:275368 6/21 (29%)
znf367NP_001017726.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..97 8/41 (20%)
COG5048 115..>182 CDD:227381 25/66 (38%)
C2H2 Zn finger 123..143 CDD:275368 5/19 (26%)
C2H2 Zn finger 151..173 CDD:275368 9/21 (43%)
C2H2 Zn finger 181..200 CDD:275368 6/21 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..294
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1943
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.