DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pho and YY2

DIOPT Version :9

Sequence 1:NP_524630.1 Gene:pho / 43819 FlyBaseID:FBgn0002521 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_996806.2 Gene:YY2 / 404281 HGNCID:31684 Length:372 Species:Homo sapiens


Alignment Length:439 Identity:151/439 - (34%)
Similarity:184/439 - (41%) Gaps:190/439 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 FKNIGYGEN------------------------------------------QETSKVLTNSLSNN 115
            |.|.|||::                                          |.|...|:.|.::.
Human    66 FTNTGYGDHDQEMLMLQTQEEVVGYCDSDNQLGNDLEDQLALPDSIEDEHFQMTLASLSASAAST 130

  Fly   116 DINTEESGVVDKNSPFLTLGT-TILNSNGKS-----RRWEQKLVHIKTMEGEFSVTMWASGISDD 174
            ..:|:.........|.....| |..|..|.|     |:||||.:.:||:|||||||||:...::|
Human   131 STSTQSRSKKPSKKPSGKSATSTEANPAGSSSSLGTRKWEQKQMQVKTLEGEFSVTMWSPNDNND 195

  Fly   175 EYS-GSDQIVGA---SDLLKGKE-----EFGIDGFTSQQNKEYQKMESKFTNAQTLEMPHPISSV 230
            :.: |..|....   |:.||||:     ..|||....:|..|:.|::.|                
Human   196 QGAVGEGQAENPPDYSEYLKGKKLPPGGLPGIDLSDPKQLAEFTKVKPK---------------- 244

  Fly   231 QIMDHLIKERGNLSQENNISERILSKTTLSFEEPILLPDSSSIELVNETAAMTINNHRTLSNHTG 295
                   :.:|                     ||                               
Human   245 -------RSKG---------------------EP------------------------------- 250

  Fly   296 NTGDLHALPSSVPFRIGLHEGQVNDCLSTISQSTHQDNTDSTGCGEMNLSEVTVSYTNDKKIACP 360
                    |.:||                                                  |.
Human   251 --------PKTVP--------------------------------------------------CS 257

  Fly   361 HKGCNKHFRDSSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRF 425
            :.||.|.|||.:|||||||.|||||||||||||||:|||||:|||||||||||||||||||||||
Human   258 YSGCEKMFRDYAAMRKHLHIHGPRVHVCAECGKAFLESSKLRRHQLVHTGEKPFQCTFEGCGKRF 322

  Fly   426 SLDFNLRTHVRIHTGDRPFVCPFDACNKKFAQSTNLKSHILTHAKAKRN 474
            |||||||||:||||||:|||||||.||:|||||||||:|||||.|.|.|
Human   323 SLDFNLRTHLRIHTGDKPFVCPFDVCNRKFAQSTNLKTHILTHVKTKNN 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
phoNP_524630.1 Transpos_assoc <342..382 CDD:290671 14/39 (36%)
C2H2 Zn finger 359..381 CDD:275368 14/21 (67%)
COG5048 <386..515 CDD:227381 79/89 (89%)
zf-C2H2 386..408 CDD:278523 19/21 (90%)
C2H2 Zn finger 388..408 CDD:275368 17/19 (89%)
zf-H2C2_2 401..426 CDD:290200 23/24 (96%)
C2H2 Zn finger 416..438 CDD:275368 20/21 (95%)
zf-H2C2_2 430..457 CDD:290200 22/26 (85%)
C2H2 Zn finger 446..468 CDD:275368 18/21 (86%)
YY2NP_996806.2 Mediates transcriptional activation 32..102 5/35 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..172 11/45 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..210 6/23 (26%)
Mediates transcriptional repression 237..372 107/268 (40%)
zf-C2H2_8 255..334 CDD:292531 67/128 (52%)
C2H2 Zn finger 256..278 CDD:275368 14/21 (67%)
C2H2 Zn finger 285..305 CDD:275368 17/19 (89%)
zf-H2C2_2 298..323 CDD:290200 23/24 (96%)
COG5048 <309..>372 CDD:227381 55/63 (87%)
C2H2 Zn finger 313..335 CDD:275368 20/21 (95%)
zf-H2C2_2 327..354 CDD:290200 22/26 (85%)
C2H2 Zn finger 343..365 CDD:275368 18/21 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BEPX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 275 1.000 Inparanoid score I2975
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D362296at33208
OrthoFinder 1 1.000 - - FOG0003443
OrthoInspector 1 1.000 - - otm42215
orthoMCL 1 0.900 - - OOG6_104913
Panther 1 1.100 - - O PTHR14003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3337
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.