DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pho and SPAC25B8.19c

DIOPT Version :9

Sequence 1:NP_524630.1 Gene:pho / 43819 FlyBaseID:FBgn0002521 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_594479.2 Gene:SPAC25B8.19c / 2542738 PomBaseID:SPAC25B8.19c Length:522 Species:Schizosaccharomyces pombe


Alignment Length:243 Identity:70/243 - (28%)
Similarity:103/243 - (42%) Gaps:42/243 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 EYQKMESKFTNAQTLEMPHPISSV-----QIMDHLIKERGNLSQENNISERILSKTTLSFEEPIL 266
            :||.......|..|::... :|||     ..::|     .|.:|..|.||...|::..| :.|..
pombe   309 QYQPSSRDLQNHPTVDESR-LSSVAPPASNTLNH-----ANGNQAENASESSTSQSNDS-QGPAN 366

  Fly   267 LPDSSSIELVNETAAMTINNHRTLSNH----TGNTGDLHALPSSVPFRIGLHEGQVNDCLSTISQ 327
            .....|:.|.|:..    ||| |||.:    :.|..|..:...||...:..:..|.:. :...|.
pombe   367 TSYPVSVPLPNDAE----NNH-TLSRNPYIPSLNFKDNMSAELSVVATLASNSAQAHP-MGQQSD 425

  Fly   328 STHQD--NTDSTGCGEMNLSEVTVSYTNDKKIACPHKGCNKHFRDSSAMRKHLHTHGPRVHVCAE 390
            |.:.|  |.|..       :.|:..::..:|||..|.|.:.   .|||....        :.|.|
pombe   426 SNYSDHHNNDKR-------AHVSRRHSTSRKIAQSHTGSSS---TSSAANVR--------YRCTE 472

  Fly   391 CGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIH 438
            |.:.|...|.||.|...||||:||.|.:.||||.|::..|:|.|.|||
pombe   473 CLQGFSRPSSLKIHTYSHTGERPFVCDYAGCGKAFNVRSNMRRHQRIH 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
phoNP_524630.1 Transpos_assoc <342..382 CDD:290671 9/39 (23%)
C2H2 Zn finger 359..381 CDD:275368 5/21 (24%)
COG5048 <386..515 CDD:227381 26/53 (49%)
zf-C2H2 386..408 CDD:278523 8/21 (38%)
C2H2 Zn finger 388..408 CDD:275368 8/19 (42%)
zf-H2C2_2 401..426 CDD:290200 14/24 (58%)
C2H2 Zn finger 416..438 CDD:275368 10/21 (48%)
zf-H2C2_2 430..457 CDD:290200 6/9 (67%)
C2H2 Zn finger 446..468 CDD:275368
SPAC25B8.19cNP_594479.2 C2H2 Zn finger 470..490 CDD:275368 8/19 (42%)
zf-H2C2_2 482..508 CDD:290200 14/25 (56%)
C2H2 Zn finger 498..520 CDD:275368 10/21 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1943
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.