DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pho and Zfp367

DIOPT Version :9

Sequence 1:NP_524630.1 Gene:pho / 43819 FlyBaseID:FBgn0002521 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_780703.1 Gene:Zfp367 / 238673 MGIID:2442266 Length:340 Species:Mus musculus


Alignment Length:173 Identity:52/173 - (30%)
Similarity:77/173 - (44%) Gaps:26/173 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 GCGEMNLSEVTVSYTNDKKIA-CPHKGCNKHFRD--------SSAMRKHLH--THGPRVHVCAEC 391
            |..:.:.|...||...|::.| .|..|   |.:|        :..:|..::  .|......|..|
Mouse   101 GAPQSSASVAAVSGGEDEEEASSPDSG---HLKDGIRRGRPRADTVRDLINEGEHSSSRIRCNIC 162

  Fly   392 GKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPFVCPFDACNKKFA 456
            .:.|.....|:.|:..||||:|:.|.:..|||.|.....|:||.|:|||::||||..:.|..:| 
Mouse   163 NRVFPREKSLQAHKRTHTGERPYLCDYPDCGKAFVQSGQLKTHQRLHTGEKPFVCSENGCLSRF- 226

  Fly   457 QSTNLKSHILTH--AKAKRNTSISGKSGCSNAESNSQSEDTSA 497
              |:...|...|  |:.||...       ::|.|..||.|..|
Mouse   227 --THANRHCPKHPYARLKREEP-------TDALSKHQSPDNKA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
phoNP_524630.1 Transpos_assoc <342..382 CDD:290671 10/50 (20%)
C2H2 Zn finger 359..381 CDD:275368 5/31 (16%)
COG5048 <386..515 CDD:227381 40/114 (35%)
zf-C2H2 386..408 CDD:278523 5/21 (24%)
C2H2 Zn finger 388..408 CDD:275368 5/19 (26%)
zf-H2C2_2 401..426 CDD:290200 11/24 (46%)
C2H2 Zn finger 416..438 CDD:275368 9/21 (43%)
zf-H2C2_2 430..457 CDD:290200 13/26 (50%)
C2H2 Zn finger 446..468 CDD:275368 5/21 (24%)
Zfp367NP_780703.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..140 10/41 (24%)
COG5048 157..>230 CDD:227381 29/75 (39%)
zf-C2H2 158..179 CDD:278523 5/20 (25%)
C2H2 Zn finger 159..179 CDD:275368 5/19 (26%)
zf-H2C2_2 171..198 CDD:290200 12/26 (46%)
C2H2 Zn finger 187..209 CDD:275368 9/21 (43%)
zf-H2C2_2 202..228 CDD:290200 13/28 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..317
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1943
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.