DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pho and ZNF367

DIOPT Version :9

Sequence 1:NP_524630.1 Gene:pho / 43819 FlyBaseID:FBgn0002521 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_710162.1 Gene:ZNF367 / 195828 HGNCID:18320 Length:350 Species:Homo sapiens


Alignment Length:165 Identity:49/165 - (29%)
Similarity:75/165 - (45%) Gaps:24/165 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 NDKKIACPHKGCNKHFRDSSAMRKHLHTH-GPRVHVC--AECGKAFVESSKLKRHQLVHTGEKPF 414
            :..:|.|  ..||:.|....:::.|..|| |.|.::|  .:||||||:|.:||.||.:|||||||
Human   163 SSSRIRC--NICNRVFPREKSLQAHKRTHTGERPYLCDYPDCGKAFVQSGQLKTHQRLHTGEKPF 225

  Fly   415 QCTFEGCGKRFSLDFNLRTHVRIHTGDRPFVC-----PFDACNKKFAQSTNLKSHILT---HAKA 471
            .|:..||..||       ||...|....|:..     |.|..:|..|......:..|.   ..:.
Human   226 VCSENGCLSRF-------THANRHCPKHPYARLKREEPTDTLSKHQAADNKAAAEWLARYWEMRE 283

  Fly   472 KRNTSISGKSGCSNAESNSQSEDTSANYVKVELQD 506
            :|..::.||.    .:...|.:.....|::.:.:|
Human   284 QRTPTLKGKL----VQKADQEQQDPLEYLQSDEED 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
phoNP_524630.1 Transpos_assoc <342..382 CDD:290671 8/29 (28%)
C2H2 Zn finger 359..381 CDD:275368 5/21 (24%)
COG5048 <386..515 CDD:227381 39/131 (30%)
zf-C2H2 386..408 CDD:278523 12/23 (52%)
C2H2 Zn finger 388..408 CDD:275368 12/21 (57%)
zf-H2C2_2 401..426 CDD:290200 15/24 (63%)
C2H2 Zn finger 416..438 CDD:275368 7/21 (33%)
zf-H2C2_2 430..457 CDD:290200 7/31 (23%)
C2H2 Zn finger 446..468 CDD:275368 5/29 (17%)
ZNF367NP_710162.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..151
COG5048 167..>240 CDD:227381 36/81 (44%)
zf-C2H2 168..189 CDD:278523 5/22 (23%)
C2H2 Zn finger 169..189 CDD:275368 5/21 (24%)
zf-H2C2_2 181..208 CDD:290200 11/26 (42%)
C2H2 Zn finger 197..219 CDD:275368 12/21 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 290..327 5/29 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1943
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.