DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pho and sem-4

DIOPT Version :9

Sequence 1:NP_524630.1 Gene:pho / 43819 FlyBaseID:FBgn0002521 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_491997.1 Gene:sem-4 / 172435 WormBaseID:WBGene00004773 Length:744 Species:Caenorhabditis elegans


Alignment Length:354 Identity:81/354 - (22%)
Similarity:125/354 - (35%) Gaps:69/354 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 QQNKEYQKMESKFTNAQTLEMPHPISSVQIMDHLIKERGNLSQENNISERILSKTTLSFEEPILL 267
            |.:::....:.:|.||..|.:           |:.:.|.:|:|...:   :.:.||...:....:
 Worm   408 QASQQCPICQQRFLNAGELAV-----------HITEHRNSLTQPPRV---MPTPTTTRVQTFPFV 458

  Fly   268 PDSSSIELVNETAAMT-INNHRTLSNHTGNTGDLHALPSSV---------PFRIGLHEGQVNDCL 322
            |..::...:|.|...| .|....||....|....:...|||         |....|.....:|. 
 Worm   459 PFFTTPPSLNATDMSTQFNLANILSAQLKNDSSPNTDTSSVEEKITRDDPPKMASLSPSNSSDS- 522

  Fly   323 STISQSTHQDNTDST-------GCGEMNLSEVTVSYTNDKKIACPHKGCNKHFRDSSAMRKHLHT 380
               |.|..||..:|:       ...|..:.|..||.|.:.|...|.....|.:.::       ..
 Worm   523 ---SSSVRQDILESSEFEEKLKKLEEPPILEQQVSTTPNPKNENPLLAMQKMWAET-------EP 577

  Fly   381 HGPR------VHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHT 439
            ..||      .|.|..|.|.|..||.|:.|...|||:|||:|  :.||:.|:...||:.|:..|:
 Worm   578 PPPRQMPVLSKHQCGVCFKHFSSSSALQIHMRTHTGDKPFKC--DMCGRAFTTRGNLKVHMGTHS 640

  Fly   440 --------GDRPFVCPFDACNKKFAQSTNLKSHILTHAKAKRNTSISGKSG-----------CSN 485
                    |.|.|........|...||..|.:.....|........:|.||           ||.
 Worm   641 WQQSPSRRGRRIFDVASSVTEKPMLQSPILPTSGAPGASPLAMLGPNGLSGLEMMMMLWRTVCSV 705

  Fly   486 AESNSQSEDTSANYVKVELQDSVTENHVP 514
            .:...||.:....::|..|.:..:....|
 Worm   706 CQKVCQSPNELEQHLKEHLNNGSSAAPTP 734

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
phoNP_524630.1 Transpos_assoc <342..382 CDD:290671 7/39 (18%)
C2H2 Zn finger 359..381 CDD:275368 2/21 (10%)
COG5048 <386..515 CDD:227381 41/148 (28%)
zf-C2H2 386..408 CDD:278523 9/21 (43%)
C2H2 Zn finger 388..408 CDD:275368 8/19 (42%)
zf-H2C2_2 401..426 CDD:290200 11/24 (46%)
C2H2 Zn finger 416..438 CDD:275368 7/21 (33%)
zf-H2C2_2 430..457 CDD:290200 8/34 (24%)
C2H2 Zn finger 446..468 CDD:275368 4/21 (19%)
sem-4NP_491997.1 C2H2 Zn finger 307..327 CDD:275368
zf-H2C2_2 319..344 CDD:290200
C2H2 Zn finger 335..355 CDD:275368
lambda-1 553..>610 CDD:212564 17/63 (27%)
zf-C2H2 589..611 CDD:278523 9/21 (43%)
C2H2 Zn finger 591..611 CDD:275368 8/19 (42%)
zf-H2C2_2 603..628 CDD:290200 12/26 (46%)
C2H2 Zn finger 619..639 CDD:275368 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1943
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.