DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bt and LRRC4B

DIOPT Version :9

Sequence 1:NP_001162825.1 Gene:bt / 43814 FlyBaseID:FBgn0005666 Length:8933 Species:Drosophila melanogaster
Sequence 2:NP_001073926.1 Gene:LRRC4B / 94030 HGNCID:25042 Length:713 Species:Homo sapiens


Alignment Length:432 Identity:91/432 - (21%)
Similarity:132/432 - (30%) Gaps:130/432 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 DVHSYFATLEILNVTVEDAGKYKVNAKNELGESNATISLNFDSDEAPVPESA------------- 223
            |...:...||||.::.....|.:|.|.|.|...| |:.| ||:....||..|             
Human   104 DTFKHLRHLEILQLSKNLVRKIEVGAFNGLPSLN-TLEL-FDNRLTTVPTQAFEYLSKLRELWLR 166

  Fly   224 ----EGIKP-TFTERPVIRQSEDG--------GNVTFE------------CRCVGDPTPTVTWSH 263
                |.|.. .|...|.:|:.:.|        ....||            |.....|..|.....
Human   167 NNPIESIPSYAFNRVPSLRRLDLGELKRLEYISEAAFEGLVNLRYLNLGMCNLKDIPNLTALVRL 231

  Fly   264 GETELNESNRYKM-------SLTMDQKLYHIACLEISSVVSSDQGEYRAQAKNKHGSGVATINLN 321
            .|.||: .||..:       .||..:||:.:                .||        ||||..|
Human   232 EELELS-GNRLDLIRPGSFQGLTSLRKLWLM----------------HAQ--------VATIERN 271

  Fly   322 FESGSKKIPDGKSPRFPKKPTIRQEEDLLIMECVLEAHPVPDIVWYCS---------EKEICNNQ 377
            .....|.:   :.........:....||......||...:....|:|:         .||...:.
Human   272 AFDDLKSL---EELNLSHNNLMSLPHDLFTPLHRLERVHLNHNPWHCNCDVLWLSWWLKETVPSN 333

  Fly   378 RTKMTR---KAITKDSYILTLEIQNPTKEDGGNYRCNAINMYGESNANIALNFQGASDANGFAPS 439
            .|...|   .|..|..||..|        |..::.|                         :||.
Human   334 TTCCARCHAPAGLKGRYIGEL--------DQSHFTC-------------------------YAPV 365

  Fly   440 FIEKPRIIPNESGTLITMKCKCKAKPEPTVTWY--RGQDLVEKSKKIKINTTVIAEDTYELTLEI 502
            .:|.|..:....|....:||: ......:|.|.  .|..:...|.:::|:.      .::.||..
Human   366 IVEPPTDLNVTEGMAAELKCR-TGTSMTSVNWLTPNGTLMTHGSYRVRISV------LHDGTLNF 423

  Fly   503 KDPGATDGGTYRCNVKNEYGESNANLNLNIEAEPEPEGEGPT 544
            .:....|.|.|.|.|.|..|.:.|:..||:.| .:|...|.|
Human   424 TNVTVQDTGQYTCMVTNSAGNTTASATLNVSA-VDPVAAGGT 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btNP_001162825.1 I-set 9..101 CDD:254352
Ig 26..100 CDD:143165
I-set 119..210 CDD:254352 12/37 (32%)
Ig 136..209 CDD:143165 12/36 (33%)
I-set 228..320 CDD:254352 24/119 (20%)
IGc2 242..312 CDD:197706 17/96 (18%)
I-set 335..425 CDD:254352 17/101 (17%)
Ig 350..423 CDD:143165 15/84 (18%)
Ig 436..530 CDD:299845 22/95 (23%)
I-set 438..532 CDD:254352 22/95 (23%)
I-set 545..636 CDD:254352 91/432 (21%)
Ig 560..633 CDD:143165
Ig 657..731 CDD:143165
I-set 746..835 CDD:254352
Ig 1496..1586 CDD:299845
IG_like 1503..1588 CDD:214653
I-set 1639..1724 CDD:254352
IG 1750..1821 CDD:214652
IGc2 1750..1806 CDD:197706
I-set 1826..1909 CDD:254352
Ig 1831..1897 CDD:299845
I-set 1914..1998 CDD:254352
Ig 2020..2095 CDD:299845
FN3 2100..2194 CDD:238020
FN3 2203..2292 CDD:238020
I-set 2311..2395 CDD:254352
Ig 2321..2395 CDD:299845
FN3 2399..2493 CDD:238020
FN3 2501..2590 CDD:238020
I-set 2602..2693 CDD:254352
Ig 2619..2693 CDD:299845
FN3 2697..2793 CDD:238020
FN3 2801..2893 CDD:238020
I-set 2902..2995 CDD:254352
Ig 2919..2993 CDD:299845
FN3 2999..3088 CDD:238020
FN3 3102..3191 CDD:238020
I-set 3208..3292 CDD:254352
Ig 3219..3292 CDD:299845
FN3 3296..3390 CDD:238020
FN3 3400..3489 CDD:238020
I-set 3494..3590 CDD:254352
Ig 3516..3590 CDD:299845
FN3 3594..3682 CDD:238020
FN3 3694..3781 CDD:238020
I-set 3795..3885 CDD:254352
Ig 3813..3885 CDD:299845
FN3 3889..3980 CDD:238020
FN3 3990..4082 CDD:238020
I-set 4090..4181 CDD:254352
Ig 4108..4181 CDD:299845
FN3 4185..4271 CDD:238020
FN3 4285..4383 CDD:238020
Ig 4404..4480 CDD:299845
FN3 4484..4571 CDD:238020
FN3 4584..4677 CDD:238020
I-set 4685..4775 CDD:254352
Ig 4703..4775 CDD:299845
FN3 4779..4863 CDD:238020
FN3 4879..4970 CDD:238020
IG 4989..5069 CDD:214652
Ig 4996..5069 CDD:299845
FN3 5073..5166 CDD:238020
FN3 5175..5265 CDD:238020
I-set 5276..5366 CDD:254352
Ig 5293..5366 CDD:299845
FN3 5370..5462 CDD:238020
FN3 5470..5561 CDD:238020
Ig 5559..5654 CDD:299845
I-set 5570..5660 CDD:254352
FN3 5664..5755 CDD:238020
FN3 5764..5853 CDD:238020
I-set 5865..5954 CDD:254352
Ig 5882..5954 CDD:299845
FN3 5958..6049 CDD:238020
FN3 6062..6153 CDD:238020
I-set 6173..6255 CDD:254352
Ig_Titin_like 6182..6255 CDD:143225
FN3 6259..6350 CDD:238020
FN3 6359..6451 CDD:238020
FN3 6470..6552 CDD:238020
I-set 6564..6650 CDD:254352
Ig_Titin_like 6577..6650 CDD:143225
FN3 6654..6745 CDD:238020
FN3 6754..6840 CDD:238020
I-set 6855..6946 CDD:254352
Ig 6874..6946 CDD:299845
FN3 6950..7042 CDD:238020
FN3 7050..7139 CDD:238020
FN3 7151..7237 CDD:238020
I-set 7254..7334 CDD:254352
Ig 7272..7339 CDD:143165
IG_like 7354..7440 CDD:214653
Ig 7366..7440 CDD:299845
FN3 7444..7531 CDD:238020
FN3 7545..7637 CDD:238020
I-set 7648..7737 CDD:254352
Ig 7665..7734 CDD:143165
Ig 7760..7833 CDD:299845
FN3 7837..7927 CDD:238020
STKc_Twitchin_like 7986..8244 CDD:271016
S_TKc 7989..8244 CDD:214567
Ig 8311..8394 CDD:299845
I-set 8312..8401 CDD:254352
I-set 8437..8525 CDD:254352
Ig 8455..8519 CDD:143165
I-set 8632..8721 CDD:254352
IGc2 8646..8711 CDD:197706
I-set 8740..8831 CDD:254352
Ig 8757..8826 CDD:143165
I-set 8839..8922 CDD:254352
Ig 8845..>8909 CDD:299845
LRRC4BNP_001073926.1 LRRNT 57..90 CDD:214470
LRR <76..297 CDD:227223 47/222 (21%)
LRR 1 87..108 1/3 (33%)
leucine-rich repeat 88..111 CDD:275380 1/6 (17%)
LRR 2 111..132 7/20 (35%)
leucine-rich repeat 112..135 CDD:275380 9/22 (41%)
LRR 3 135..156 8/22 (36%)
leucine-rich repeat 136..159 CDD:275380 8/24 (33%)
LRR 4 159..180 3/20 (15%)
leucine-rich repeat 160..183 CDD:275380 3/22 (14%)
LRR 5 183..205 3/21 (14%)
leucine-rich repeat 184..208 CDD:275380 4/23 (17%)
LRR 6 208..229 3/20 (15%)
leucine-rich repeat 209..230 CDD:275380 3/20 (15%)
LRR 7 230..251 5/21 (24%)
leucine-rich repeat 231..254 CDD:275380 6/23 (26%)
LRR 8 254..275 9/44 (20%)
leucine-rich repeat 255..278 CDD:275380 9/46 (20%)
LRR 9 278..299 2/23 (9%)
leucine-rich repeat 279..300 CDD:275380 2/23 (9%)
LRRCT 311..361 CDD:214507 12/57 (21%)
I-set 364..453 CDD:254352 22/95 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 497..551
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 694..713
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.