DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bt and ttn

DIOPT Version :9

Sequence 1:NP_001162825.1 Gene:bt / 43814 FlyBaseID:FBgn0005666 Length:8933 Species:Drosophila melanogaster
Sequence 2:XP_031748776.1 Gene:ttn / 733882 XenbaseID:XB-GENE-6031746 Length:33494 Species:Xenopus tropicalis


Alignment Length:11209 Identity:2764/11209 - (24%)
Similarity:4271/11209 - (38%) Gaps:3169/11209 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DFAPSFVKKPQLHQEDDGNRL-----------IFECQLLSSPKP--------DI-------EWF- 43
            ||:.|.:.|....::.....|           :|..::|..|.|        |:       .|. 
 Frog 21785 DFSTSLINKDSARKDGGAYTLTASNPGGFAKHVFNVKVLDRPGPCEGPLSVSDVTCEKCVLSWLP 21849

  Fly    44 -------RSDNKVVE--------------DVR-TKFKIQPVGE-NKYTVVLELDDVVETDAGLYK 85
                   :.|:.|||              ||: ||||:..:.: |:|               :::
 Frog 21850 PMDDGGAKIDHYVVEKRETSRLAWTNVATDVQVTKFKVTKLLKGNEY---------------IFR 21899

  Fly    86 VKAKNK--SGEVSAS---INLN-FTPADEPKEKQIDGFAPTFAKKPAI-----RQEEDGKRLLFE 139
            |.|.||  .|||..|   :.:| :.|.|.||..::     |...|.::     ..|.||...:..
 Frog 21900 VMAVNKYGVGEVLESEPVLAVNPYVPPDPPKTPEV-----TAITKDSMIVCWGHPESDGGSPITN 21959

  Fly   140 CRVNADPIPAIIWFHNGAAVKESERHKITVDKDVHSYFATLEILNVTVEDAGKYKVNAKNELGES 204
            ..|.......:.|......:....|:|::...:.|.:               :|::.|:|..|.|
 Frog 21960 YVVERRDKAGLRWIKCNKRILTDLRYKVSGLTEGHEF---------------EYRIMAENAAGLS 22009

  Fly   205 NATISLNF----DSDEAPVPESAEGI----KPTFT---ERPVIRQSEDGGN-VT----------- 246
            ..:....|    |:...|.|.....:    |.:.|   .:||.    |||: :|           
 Frog 22010 KPSPCSQFYKACDTVFKPGPPGNPRVLDTSKSSITIAWNKPVY----DGGSEITGYMVEICLPEE 22070

  Fly   247 FECRCVGDPTPTVTWSHGETELNESNRYKMSLTMDQKLYHIACLEISSVVSSDQGEYRAQAKNKH 311
            .|.:.|..|......|...|.|.|:..||:::                           .|.|..
 Frog 22071 DEWKVVTPPAGLKATSFTITGLKENQEYKINI---------------------------YALNSE 22108

  Fly   312 GSGVATINLNFESGSKKIPDGKSPRFPKKPTIRQEEDLLIMECV-----------LEAHPVPDIV 365
            |.|...:    ..||.|..:...|     |.|..:.:|..:.|:           ::..|.|::.
 Frog 22109 GVGEPAL----VPGSPKAEERMLP-----PEIELDAELRKVICIRACCTLRLFVPIKGRPAPEVK 22164

  Fly   366 WYCSEKEICNNQRTKMTRKAITKDSYILTLEIQNPTKEDGGNYRCNAINMYGESNANI---ALNF 427
            |.....|       .:.|.:|...|...:|.::|..:.|.|.|.....|..|..:|.:   .|:.
 Frog 22165 WTRENGE-------PIERASIESTSSYTSLIVENVNRFDSGKYMLTIENSSGSKSAFVNVRVLDT 22222

  Fly   428 QGASDANGFAPSFIEKPRIIPNESGTLITMKCKCKAKPEPTVTW-------------YRGQDLVE 479
            .||                 |.:      :|.|...|...|::|             |    :||
 Frog 22223 PGA-----------------PQD------LKIKEITKESVTLSWEPPLIDGGSKIKNY----IVE 22260

  Fly   480 KSKKIKINTTVIAEDTYELTLEIKDPGATDGGTY--RCNVKNEYG---ESNANLNLNIEAEPEPE 539
            |.:..:...:.:|.:.::.:.::..  ..:|..|  |...:||||   ....:.::.:...|.|.
 Frog 22261 KRESTRKAYSTVAANCHKTSWKVDQ--LQEGCNYYFRVLAENEYGIGLPVETSESVKVSERPLPP 22323

  Fly   540 GEGPTFI-----------EKPRIVSENNGKLVIMECKVKADPKPDVIWFRNGEVIKESNKIKTFI 593
            |: .|.:           |||    |::|...|:...|:...|....|.....|.....||...|
 Frog 22324 GK-ITLVDVTRNSVSLTWEKP----EHDGGSRILAYIVEMQSKGSEKWATCSTVKTTEAKITGLI 22383

  Fly   594 EQRGDQYYIKLELLDPQLEDSGLYKCNIKNTLG-----ELNANLTL-NIEIVPVIKDKPKIIKII 652
            :  |::|               :::.:.:|..|     :|...:.. ::.|.|..|.......::
 Frog 22384 Q--GEEY---------------MFRVSAQNEKGISDPRQLGVPVVAKDLVIAPAFKLLFNTFSVL 22431

  Fly   653 KKRTVVIECTVASKFEPKCTWYKETSTVKESKRHVYQVEQTKEGEFAVKLEINDVEESDKGAYKL 717
            ....:.::....::.:|..||:|:...:|::.|  ...|.|:....   |.|.:..:.|.|.|.:
 Frog 22432 AGEDLKVDVPFVARPKPTVTWHKDNLPLKQTTR--VNAENTESNSL---LTIKEASKEDVGQYTV 22491

  Fly   718 VASNEKGEAVSQI-VNLVDIPEEERKPCKPEISRKLADQKVAESKTFELLVSLSQTDRKCKVEW- 780
            ..:|..|||..|: :.::|.||....|.|       .|:..|:|.|               :.| 
 Frog 22492 TLANSAGEATEQLSIVVLDKPEPPTGPVK-------IDEVTADSVT---------------ISWQ 22534

  Fly   781 ---YKGSTVIR----ETKDITTT----FDGTTARLTFSSARTEHTSNY--KVIVTNEVGKDESSC 832
               |.|.:.|.    |.:|.:||    ...|.||.|..:.|.:....|  ::...|..||   |.
 Frog 22535 PPKYDGGSSINNYIVEKRDTSTTNWQIVSATVARTTIKATRLKTGCEYQFRIAAENRYGK---SG 22596

  Fly   833 KITVEKVAKKKEEK-------PKEKEKTKNEKEVEQKEMEEDKNES--GQSVAQTE--------- 879
            .:|.|.|..:...|       |.....|::...|:..|...|....  |..|...|         
 Frog 22597 YLTSESVIAQYPYKLPGPPGTPFVTAVTRDSMVVQWNEPVNDGGSKILGYHVESKERNSILWVKL 22661

  Fly   880 -------GRINIEQISEG-------------------------------DP----------KEEL 896
                   .||....|.||                               ||          :..:
 Frog 22662 NKTILPDTRIKTTNIEEGIEYEFRVYAENIVGIGKPSKVSECYVARDPCDPPGRPEPVIVTRNSV 22726

  Fly   897 TV---KEE----------ILDKRDTQE---------------------VKESSVELQ-------- 919
            |:   |.|          |::|::..|                     |::...|.:        
 Frog 22727 TLQWTKPEYDGGSKITGYIVEKKELPEGRWMKASFTNVIETEFAVTGLVEDQRYEFRVIARNAAG 22791

  Fly   920 ------DSAG----HEVPEPKKATSDSKLDQSNQKNLDKKHKTDQSESKTNKNVSLAEPIKSNK- 973
                  ||.|    .:..||.:.:.|.|..::...|..:..|.|....        .:||.|.: 
 Frog 22792 IFSEPSDSTGPITARDEVEPPRVSMDPKYKETITVNAGETFKIDADVH--------GKPIPSIQW 22848

  Fly   974 -QESEEQQATEQIGLKKVDRKASIVSVKEEISSDVRRKS----TIKAKEEITVDDK---KASSRR 1030
             :..||...|.::.:|..|...|: ||||.|.:|....:    .:..::.::|:.|   :.....
 Frog 22849 IKAGEELANTARLEIKNTDFTTSL-SVKEAIRTDSGHYNLLLKNVAGEKSVSVNIKVLDRPGPPE 22912

  Fly  1031 SSLAVEESNTESRRSSIIDKKPLEQVDNKPID----------------ANKNPQPLKEEIPRLKP 1079
            ..:|:...:.|   ...:..||.:|.....|.                .:.|.|.|..::.:|..
 Frog 22913 GPIAITGVSAE---KCTLTWKPPQQDGGSDISHYIVERRETSRLVWTVVDSNVQTLSCKVTKLLE 22974

  Fly  1080 AEKR--RTSKV----IEEPKPDEGLPKLRKASIAQVKEEAKPAAPKLKAKAK-------AKPKYE 1131
            ..:.  |...|    :.||...|  |.|  |....|..:| |.||::.|..|       .:|.::
 Frog 22975 GNEYIFRVMAVNKYGVGEPLESE--PVL--ARNPYVVPQA-PKAPEVTAITKDSMIVVWERPAFD 23034

  Fly  1132 ELPEIPDYERPQLEKYEK-----------------------------------------SDFTPS 1155
            ...||..|   .|||.:|                                         |:.:||
 Frog 23035 GGSEITGY---VLEKRDKEGIRWTRCNKRIISELRFRVTGLVESHLYEFRVSAENAAGLSEPSPS 23096

  Fly  1156 ----------------------DFARDLEIPNKMEKPIIDSG--------------KKEPAVLAQ 1184
                                  |..|...|.: ..|||.|.|              .:|.::...
 Frog 23097 SIYYKASDPIYKPGPPNNPRVVDVTRSSVILS-WGKPIYDGGCEIQGYIVEKCDLSSEEWSICTP 23160

  Fly  1185 KNGIPKKT-----DIIEQYADEPKGLKVGKGKLPDEGDGRDGAVLKPVIIEPEKEILDLGNKKNN 1244
            .:|| |:|     .::|::..:.:...|.|.     |.|....:...:|:|.:.|:.||..    
 Frog 23161 PSGI-KETRFEVEKLLEKHEYKFRICAVNKA-----GVGEHADLPASIIVEEKLEVPDLDL---- 23215

  Fly  1245 QHADKPTVLDIIKQRRRSSIRNLMTKEPIQNESFLGVVLKPVIKDTREQA--------------- 1294
                .|.:..|:..|...|:|..:   |.:......|....|..|.|:.|               
 Frog 23216 ----DPELRKIVNVRAGGSLRLFI---PFRGRPAPEVKWGKVEGDIRDIAQIDVTSSFTSLVIDN 23273

  Fly  1295 -----APQQAIQLTKANATEQF--------SPTKAVKAQVADLKKPETLATLEDNYERPVLE--- 1343
                 :.:..:.|..::.|:..        :|::.|..::.::.|.....|    :|.|.|:   
 Frog 23274 VNRFDSGKYTLTLENSSGTKSAFISVRVLDTPSEPVNLKIKEVTKDSVSLT----WEPPALDGGA 23334

  Fly  1344 KYDPFSIDKTKSEKSTPSIITPDIRGPEVKL-PVQE--------TKEEKQKVPKMQPPAPGDPPK 1399
            |...:.|:|.::.:...:.:..:......|: .:||        |.|.:..:.  .|....||.|
 Frog 23335 KIKNYIIEKRETTRKAYAAVATNCHKTSWKIDQLQEGCSYYFRVTAENEYGIG--VPAEIADPVK 23397

  Fly  1400 IEVIREKRPSLAPEPPSR-------RGSLI-----PPADTGRRPSLII--------------NDE 1438
            :        |..|:||.:       |.|:.     |..|.|   |.||              :|.
 Frog 23398 V--------SEVPQPPGKITVVDVTRNSVSLSWEKPEHDGG---SKIIQYIVEMQAKGSEKWSDC 23451

  Fly  1439 KKLRPGEVMDTRLLRPGE-------VGEGQRRRP-SIDVRRPSVQDLEDLINKPSTPLRDVGDGG 1495
            .:::..|.:.|.|.:.||       |.|..:..| |:.|  |.|  .:||:.:|           
 Frog 23452 ARVKALEAVITNLAQGGEYLFRVVAVNEKGKSDPRSLAV--PVV--AKDLVIEP----------- 23501

  Fly  1496 PPSIVDVQ---ESYSVVEDSTAYLTVGVEGSPAPTFKFYKGVSEILEGGRFKFLTDGQTNTITLC 1557
                 ||:   .||||.......:.|.:.|.|.|...:.|....:.:..|.. :|| ..|...|.
 Frog 23502 -----DVRPAFSSYSVQVGHDLKVEVPISGRPKPEITWTKDGQPLKQTTRVN-VTD-TPNLTVLN 23559

  Fly  1558 MRKCKPNDESKYKIVVSNIHGEDSAEMQLYVSDSSGMDFRAMLKKRRYQKWDKDEQDPNWGDLKE 1622
            :::...:|...|.|.||||.|:..|.:::..                     .|:.||..|.:| 
 Frog 23560 IKETSKDDSGMYAISVSNILGQKVASIEIIT---------------------LDKPDPPCGPVK- 23602

  Fly  1623 TEKPLPALKKVERKVESFLSPLIDQFAKEGKDKKVVFEARFSKPNCKPKWLFRKDEVFTGSKFKF 1687
                                  .|..:.|               :....|               
 Frog 23603 ----------------------FDDISAE---------------SITLSW--------------- 23615

  Fly  1688 KQENDTYQLIITTPKVEDTGKYTIEIGGVSSTAFLNVEEADPTYTFTKPLKKKLEGFTQHETTLE 1752
                        .|.:     ||   ||...:.:: ||:.|.|.|..:              |:.
 Frog 23616 ------------NPPI-----YT---GGCQISNYV-VEKRDTTTTLWE--------------TVS 23645

  Fly  1753 CSVSSSMANVHWFKNNTKLESDDPRYLISKDINGNLKLIIKDSVLDDAGLYRCQLDKQPDKTECN 1817
            .:|:.:...|...|..|:.:               .|:..::......||            :..
 Frog 23646 ATVARTTLKVSKLKTGTEYQ---------------FKIFAENRYGRSFGL------------DSE 23683

  Fly  1818 LKVTEYPYK--------FVKVLKSQQCIEKDTVTLACE--IDDA-------------MGEVQWLR 1859
            ..|.:||||        |      ...|.||::.:...  |:|.             ...:.|.:
 Frog 23684 AVVAQYPYKEPGPPGTPF------SATITKDSMVVQWHEPINDGGSRVLGYHLERKERNSIMWTK 23742

  Fly  1860 NGEEIKPDKRIQIVKDGRKRKLVIKDCKVTDAGQFKCTTNADTTESEIIINYQN--RFNKKLKDT 1922
            ..:.|.||.                        .||.|...:..|.|..:..:|  ...|..|.:
 Frog 23743 INKSIIPDT------------------------YFKTTNLEEGIEYEFRVYAENIVGTGKPSKVS 23783

  Fly  1923 EA-VEREKLILDIELQDQTAPCD------------------WK---FNGEPIVPSESIEIKNMGG 1965
            |. ..|:             |||                  ||   ::|..::....:|.:::..
 Frog 23784 ECYCARD-------------PCDPPGCPEPIIVTRSAITLSWKKPEYDGGSMITGYIVEKRDLPE 23835

  Fly  1966 GKHQLIFSSLDMSN--EGEITCESGQLSSKCKLSIRKGESRPNIDCPDKFSGPISAPVLLEVPFK 2028
            |:    :.....:|  |.:.|........:....:....:......|...:|||:|...:|.| :
 Frog 23836 GR----WMKASFTNVIETQFTVTGLTEDQRYDFRVIARNAAGTFSKPSDSTGPITAKDEVEPP-R 23895

  Fly  2029 VS---GTKQTPV--EAKLFK-----DGKPLPV-------KDV------EVAVTDDKVTFKIKKPS 2070
            :|   ..|.|.|  ..:.||     .|||||.       |:|      |:..||.|....:|...
 Frog 23896 ISMDPKYKDTIVINAGETFKLDADVHGKPLPTIQWFKGDKEVEDSARCEIKNTDFKALIVVKDAI 23960

  Fly  2071 RDLSGPYQIKISNGQGEDTKDVQIICQDVPQPPQ-DVDITDVYQTSCVVSFNPPSDDGGTPITKY 2134
            |...|.|.::.||..|..:..:.:...|.|.||: .|.:|.|....|.:::.||..|||:.|:.|
 Frog 23961 RIDGGQYILQASNVAGTKSVPINVKVLDRPGPPEGPVQVTGVTSDKCSLAWAPPQHDGGSDISHY 24025

  Fly  2135 VIERQDLSKKHGWESVA-EVLPSEPCLKKIDDLIPKKQYRFRIRAVNAIGQSDPATFKNTILAKD 2198
            |||:::.|:. .|..|| ||:|:.   :|:..|:...:|.|||.|||..|..:|.. ...:|.|:
 Frog 24026 VIEKRETSRL-AWTVVATEVVPTS---QKVTKLLEGNEYIFRIMAVNKYGVGEPLE-SVPVLMKN 24085

  Fly  2199 PWDEPGKPKAVDLTDWDKDHADLKWEAPETDGGDPITAYIVEYKEKFSNDWVS-GKEVDGDARTA 2262
            |:..||.|||:::|:..||...:.|..|:.|||..|..||||.:::....|.. .|....|.| .
 Frog 24086 PFVPPGPPKALEVTNIAKDSMTVCWNRPDNDGGSEIIGYIVEKRDRAGIRWTKCNKRRVTDLR-F 24149

  Fly  2263 TVDGLKEGQQYEFRVRAVNRAGPGEPS------------------------DKTKS--------- 2294
            .|.||.|..:||:|:.|.|.||.||||                        |.:|:         
 Frog 24150 RVTGLTEDHEYEYRLSAENAAGIGEPSQASAYFKACDPIFKPGPPTNPHVVDTSKNSVTVVWGKP 24214

  Fly  2295 -----------IIAKCR------------------------------------------------ 2300
                       |:..|:                                                
 Frog 24215 IYDGGSDIQGYIVEICKEDEEEWTICTPQTGLQVTKYEITKLIEHKQYQVRICAINKAGVGEAAA 24279

  Fly  2301 ---FVKP---------FIVGEGLKNVTVKKGQTIRFDIKYDGEPEPAATWVKGTDNLKFDNQRIC 2353
               .|||         .:..|..|.:.|:.|...|..|.:.|.|.|..:|.|.      |.:...
 Frog 24280 VPGTVKPEDKLEAPEIELDSELRKGILVRAGGNARIHIPFKGRPTPEISWSKE------DGELTE 24338

  Fly  2354 LDQLERN---SSITIKKSVRKDTGKYKLVLSNSSGTIESEAQVVVLDRPLPPGGPFEPEEIRASH 2415
            ..|:||.   :.::|....|.|.|||.|.|.||||:..:...:.|||.|.||.. ...::|:...
 Frog 24339 KSQIERGLNYTQLSIDNCDRNDAGKYILTLENSSGSKSAFVTLKVLDTPGPPIN-LLVKDIKKDS 24402

  Fly  2416 IKMKWKRPDDDGGCEISGYALERMDEETGRWIPAGEVGPNETSFDFKGLTPNKKYKFRVKAINKE 2480
            :.:.|:.|..|||.:|..|.:::. |.|.:.........|:||:..:.||....|.|||.|.|:.
 Frog 24403 VTLTWEPPLIDGGAKIKNYVIDKR-ESTRKAYANVTAKCNKTSYKVENLTEGAIYYFRVMAENEY 24466

  Fly  2481 GESEPLETFDAIVARNPYDPPSPPSQPVIDDYDNKSVLLKWKRPPSDGGRPITHYIVEIKDKFAP 2545
            |...|:||.||:.|.   :.|.||.:..:.|...:|..|.|::|..|||..|..|:||::.|...
 Frog 24467 GVGVPVETVDAVKAS---EAPLPPGKISLTDVTQRSASLMWEKPEHDGGSRIIGYLVEMQPKGVE 24528

  Fly  2546 SWSEVAKTDDPNPECNVEGLKEKMVYQFRVRAVNKAGPSEPSQPTDNHLCKHKNLKPQIDRSTFK 2610
            .||.|  |:.......|.||.....|.|||.|.|:.|.|:|.......:.|...::|.. :..|.
 Frog 24529 KWSTV--TESKTCSAVVSGLSPGQEYSFRVLAYNEKGKSDPRILGIPVIAKDLTIEPSF-KLMFN 24590

  Fly  2611 RVTIKSGRTHKWSVDVLGEPIPELHWSWRDDIPLTNGDRIKIENVDYHTDFSITNVLRKDSGFYT 2675
            ...:::|...|..:.|:|.|.|.:.|: :|..||....|:.:|:....|...|....:.|.|.||
 Frog 24591 SYNVQAGEDLKIDIPVIGRPKPAITWT-KDSQPLKQTTRVNVEDTPSSTILHIKESNKDDFGKYT 24654

  Fly  2676 LKAENRNGIDRETVELVVLGKPSSPKGPLAVSDVTASGCKLQWKKPEDDGGVPIKEYVVEKMDTA 2740
            :.|.|..|...|.:.:::|.||..||||:...:::::.....|..||..||..|..|:|||.||.
 Frog 24655 VTATNTAGTATENISIIILDKPGPPKGPVRFDEISSNFVVFSWDAPEYTGGCQINNYIVEKRDTT 24719

  Fly  2741 TGKWVRVGRSPGEKEPPSFDVTGLSLGSEYMFRVSAVNEEGESEPLTTLVGVVAKDPFDEPNKPG 2805
            |..|..|..:...   .:..||.|:.||||.||:.|.|..|:|.||.: ..||.:.|:.||..||
 Frog 24720 TTAWQMVSATVAR---TTIKVTKLTTGSEYQFRIHAENRYGKSTPLDS-SAVVVQYPYKEPGPPG 24780

  Fly  2806 TPEVTDYDNQSISLKWAAPNNDGGAPIQKYIIEKKNKNKTEWEK--------------------- 2849
            ||.||......:.::|..|.||||:.:..|.:|:|.||...|.|                     
 Frog 24781 TPFVTSLSKDHMLVQWHEPVNDGGSKVLGYHLERKEKNSILWAKLNKTLIQDTKLKTNGLEEGLE 24845

  Fly  2850 ------------------------------------ALEIPGD---------------------- 2856
                                                |:||..:                      
 Frog 24846 YEFRVYAENIVGIGKVSKVSECYVARDPCDPPGRPEAIEITRNYVNLQWTKPEYDGGSKVTGYIV 24910

  Fly  2857 -------------------QLEATVAGLQEYGEYQFRVIAVNKAG-LSPPSDASVPQIVKYKKLK 2901
                               :.|..|.||.|...|:|||||.|.|| .|.||:::.|...     :
 Frog 24911 EKKELPDGRWMKASFTNVLETEFNVTGLTEDQRYEFRVIARNAAGNFSEPSESTGPITA-----R 24970

  Fly  2902 PRID--RSNLKP-----LLIRAGKPIRYDVNVRGEPAPVITWYQNDKELKPEELPSSSEIKNIPY 2959
            ..||  |::|.|     :::.||.....:.::.|:|.|.|.|.::.|||  |...:..|||:...
 Frog 24971 DEIDAPRASLDPKYKDVIIVNAGDTFVLEADIHGKPIPDIAWSKDGKEL--EAATARMEIKSTIQ 25033

  Fly  2960 NTKISIIETVRKHTGIYKIIAVNEHGQDEATVEVNILAPPSKPRGPLDVKDVTKDSCKLKWKKPE 3024
            .|.:.:.:.||...|.|.:...|..|.....:.|.:|..|..|.|||.|..||.:.|.|.|..|.
 Frog 25034 KTTLIVKDCVRVDGGQYVLNLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWGPPA 25098

  Fly  3025 DDGGKPISAYQVEKFDKKQGRWVPLGRTSANDTEFDVKGLQEGHEYQFRVKAINEEGESDPLDSD 3089
            .|||..||.|.:||.:..:..|..:. ::.......|..|..|:||.|||.|:|:.|..:||:| 
 Frog 25099 HDGGANISHYTIEKRETSRLSWTQVA-SNVQALSHKVTKLLTGNEYIFRVVAVNKYGIGEPLES- 25161

  Fly  3090 DSIIAKNPYDAASKPGTPNIVDYNEHMVKLKWEAPRSDGGAPISGYIIEKKDKFSPIWDEILSTN 3154
            :.::|:||:...|.|.||.:....:..:.:.|..|:.||||.|.|||:||:||....|.:.....
 Frog 25162 EPVLARNPFKPPSAPSTPEVTAITKDSMVVTWGRPQDDGGAEIEGYILEKRDKDGIRWTKCNKKR 25226

  Fly  3155 TSVPEATVEGLVEGNIYQFRVRAVNKAGFSDPS---------DATEPHLAKPRNLK--------- 3201
            .:.....|.||.||:.:::||.|.|.||..:||         ||..|. ..|.|.|         
 Frog 25227 LTDLRLRVTGLTEGHFFEYRVSAENAAGVGEPSEPSIFYRACDAIYPP-GPPSNPKVTDASRSSV 25290

  Fly  3202 ----------------------------------------------------------------- 3201
                                                                             
 Frog 25291 SLAWSKPIYDGGAQVSGYVIEMKESTADEWTTCTPPTGLQGKQFTVTKLKENTEYCFRICAMNSE 25355

  Fly  3202 ----------PYINRDKMKP------------IKVRAGQPVKFDVDVKGEPAPSLTWFLKETELT 3244
                      ..|..||::|            :.|||...::..|.:||.|.|.:.|...|:.|:
 Frog 25356 GVGEPAAIPGTVIAADKLEPPEIELDADLRKTVTVRASGTLRLFVTIKGRPEPEVKWEKAESTLS 25420

  Fly  3245 STGQVRLENIDYNTKLTLLDTDRKQSGQYKLRAENINGVDEAVVEVIILDKPSKPEGPIEVSDIH 3309
            ...|:.:.: .| |.|.:.:.:|..||:|.|..||.:|...|.:.|.:||.||.|.. :::.:|.
 Frog 25421 DRAQIEVTS-SY-TMLVIDNVNRFDSGKYNLTLENNSGSKTAFINVRVLDSPSAPVN-LKIKEIK 25482

  Fly  3310 KEGCKLKWRKPKDDGGIPITGYVIEKMDTATGKWVPAGSVDPEKYDIEIKGLDPNHRYQFRVKAV 3374
            |:...|.|..|..|||..||.|::||.: :|.|.....:.:..|...:|..|.....|.|||.|.
 Frog 25483 KDSVILSWEPPLIDGGSKITNYIVEKRE-STRKAYATVTSNCTKNTFKIDQLQEGGIYYFRVLAA 25546

  Fly  3375 NEEGESEPLETESAITAKNPFDVSAPPGLPELEDWDEHHVKLKWEPPIRDGGSPITNYIIEVMDK 3439
            ||.|...|..|..||...   :...|||...|.|...:...:.||.|..||||.||:||:|:..|
 Frog 25547 NEHGVGLPASTPDAIKVS---EAPLPPGRVTLLDVTRNSASISWEKPESDGGSKITSYIVEMQTK 25608

  Fly  3440 DSGEF-----VKAVETDSPVCKGVVKKLEEGQQYKFRVRAVNKAGPSDPSEQTNWHVAKPRFLKP 3499
            .|.::     ||.:|       ..:|.|..|::|.|||.|||:.|.|||.:.....|||...::|
 Frog 25609 GSEKWSTCTQVKTLE-------ATIKGLTMGEEYTFRVIAVNEKGKSDPRQLGVPVVAKDIEVQP 25666

  Fly  3500 HIDRVNLKPVIVKTGLSISLDINIRGEPAPKVEWFFNNSSVTSDEHSVKIDNVDYNTKFFVMRAQ 3564
            .::.: .....||.|..:.:||.|||.|.|.|.|..:..::..... |.:.....:|...:..|.
 Frog 25667 TVELL-FNTFSVKAGDDLKIDIPIRGRPDPAVTWKKDGQALKQTTR-VNVQVSKTSTLLSIKEAS 25729

  Fly  3565 RSQSGKYIIKATNEVGEDEAELEVTVLGKPGKPKGPLQVNDITKHSCKLKWEKPDDDGGSPIDYY 3629
            :...|.|.:.|:|..|...|.:.|.||.||| |.||:||:||:..|....|..|:.|||..|..|
 Frog 25730 KDDVGTYELTASNTAGSTTASIGVIVLDKPG-PPGPIQVDDISADSISFSWSPPEYDGGCHISNY 25793

  Fly  3630 EIEKLDPHTGQW--------------------------------------------------LPC 3644
            .:||.|..|..|                                                  .|.
 Frog 25794 VVEKRDTTTTVWELVSATVARTSIKVARLTTGSEYQFRVFAENRYGRSHYTDSPAIVAQYPFKPP 25858

  Fly  3645 GKSTEPEA---------------------------------------------------KVIGLH 3658
            |....|:.                                                   ||.||.
 Frog 25859 GPPGTPQVAHATKAFMMVTWQIPVNDGGSRVLGYHLEKKERSSILWAKVNKTLINDTQLKVTGLE 25923

  Fly  3659 EGKAYKFRVRAVNKEGESEDLETEKPIIAKNPYDEPDRPGKPEPTNWDKDFVDLAWDPPKNDGGA 3723
            ||..|::||.|.|..|..:..::.:|:.|::|.|.   ||:||.||..:..|.|:|..|:.||||
 Frog 25924 EGLMYEYRVYAENIAGIGKCSKSCEPVAARDPCDP---PGQPEVTNITRTSVSLSWTKPEYDGGA 25985

  Fly  3724 PIQKYVIQMRDKSGRAWVDSATVPGDKCNGT--------VTGVEEGHEYEFRIVAVNKAGP-SDP 3779
            .|..|:|:.|:.....|:        |||.|        ||.:.|...|:||::|.|.||. |:|
 Frog 25986 KITGYIIERRELPDGRWL--------KCNFTNIQETYFDVTALTEDVRYDFRVIAKNAAGLFSEP 26042

  Fly  3780 SDVSKSVIAK-----PRFLKPHIDRKNLQKKIMRSGQMLHIDALIKAEPPAKVTWTYNKTEIKTS 3839
            |:.:..:..|     ||.:   :|.|.....::::|::|.|:|.|...|...|:||.:..||:..
 Frog 26043 SETTGPITVKDDVDAPRIM---MDVKFRDVVVVKAGEILKINADIAGRPHPIVSWTKDGKEIEEK 26104

  Fly  3840 DHIKIENEDYKTTFIMPKVKRADRGIYIVTAKNDSGSDTVEVELEVLCKPSKPKGPLAVSNVTAE 3904
            ..::|.:.|..|...:....|.|.|.|::|.:|.:|:.::.|..:||.:|....|||.::.||||
 Frog 26105 ARVEISSTDNSTVLTVKDCIRRDSGQYVLTLQNVAGTRSLAVNCKVLDRPGPSAGPLQIAGVTAE 26169

  Fly  3905 TLHLKWEKPEDDGGDPIEQYLVERMDTETGRW-VPVLTTKTPEADVTGLTEGKEYLFRVKAVNSE 3968
            ...|.|..|:::||..|:.|:||:.:|....| :.....:|....||.|.:|.||:|||..||..
 Frog 26170 KCTLSWGPPQENGGAEIDYYIVEKRETSRIAWTICESELRTTSCKVTKLLKGNEYVFRVMGVNKY 26234

  Fly  3969 GESEPLVTDIPTKAKNPFDAADTPGKPQIVDWSGNHCDLKWRAPEDDGGASITGYIVERKDPNTG 4033
            |..|||.:: ..||.:||.....|...:|...:.....|.|..||.|||:.|.|||:||::.|:.
 Frog 26235 GVGEPLESE-AVKALDPFTVPSPPKSLEITSVTKESMTLCWARPESDGGSEIAGYIIERREKNSL 26298

  Fly  4034 KW------------------------------QKALETSTP-DC-----------------KARV 4050
            :|                              :.|...|.| ||                 |.::
 Frog 26299 RWLRVNKKPVYDLRVKSSGLREGCDYEYRVYAENAAGISAPSDCSPLIRAEDPIFLPSPPTKPKI 26363

  Fly  4051 ND----------------------------------------------------LIAGNKYQFRI 4063
            .|                                                    |.:|.:|.||:
 Frog 26364 VDSTKTSITLEWTKPLFDGGSPVTGYAVEYKKSDDSEWTTAVTNVKGTEYTVIALTSGAEYSFRV 26428

  Fly  4064 MAVNKAGKSKPSEPSDQMTAKDRFAPP--KIDRTNIKDITIKAGQHIRFDIKVSGEPPATKVW-- 4124
            .::||.|.|.|||.::....|:|...|  .||....|.:.:|:|......:...|:|....:|  
 Frog 26429 KSINKVGTSDPSESTEPHIVKEREEEPVFDIDSEMRKTLIVKSGGSFTMTVPFRGKPVPNVMWSK 26493

  Fly  4125 ----LHNKARLENDDSNYNIDMESYRTKLTVPISKRFHSGKYTLKAENESGRDEASFEVIVLDKP 4185
                |.::|.::..||         ||.||:..:.|..||||||..:|.......:..|.|||.|
 Frog 26494 PDIDLRSRAAIDTTDS---------RTSLTIEKATRNDSGKYTLTLQNVLNTATLTLVVKVLDSP 26549

  Fly  4186 GPPEGPLRVTDVHKEGCKLKWNAPLDDGGLPIDHYIIEKMDVESGRWLP-SGRFKESFAELNNLE 4249
            |||.. :.|.:|.||...|.|:.|.:|||.|:.:|.|||.:.....|:. :........::.||:
 Frog 26550 GPPSN-IIVKEVTKESAVLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNCHRLTYKVTNLQ 26613

  Fly  4250 PSHEYKFRVLAVNTEGESEPLTGEQSV-IAKNPFDEPGKPGTPEAVDWDKDHVDLVWRPPINDGG 4313
            .|..|.||:...|..|...|...:..| |.:.| ..|.|.|.....   ||.|.|.|..|.:|||
 Frog 26614 ESGVYYFRISGENEFGVGVPAETKDGVKITERP-SPPEKLGVTNVT---KDSVSLSWMKPDHDGG 26674

  Fly  4314 SPITGYVVEKREKGTDKWIKGTEITIPCLGEECKATVPT-------LNENCEYEFRVKAINAAGP 4371
            |.|.||::|..|||..||.|            | |.|.|       |.||.:|.|||.|.|.||.
 Frog 26675 SKIMGYLIEALEKGQQKWTK------------C-AVVKTTHHVIRGLKENVDYYFRVFAENQAGL 26726

  Fly  4372 GEPSDASKPIITKPRKLAPKIDRKNI--RTYNFKSGEPIFLDINISGEPAPDVTWNQNNKSVQTT 4434
            .:|.:...|:..|.:..:|:||.|..  .|...::|..:.::|.|||:|.|.||.:::...|::|
 Frog 26727 SDPKELLLPVTVKEKLESPEIDMKGYPNSTVYVRAGSNLKVEIPISGKPQPKVTLSRDGLLVKST 26791

  Fly  4435 SFSHIENLPYNTK-----YINNNPE--RKDTGLYKISAHNFYGQDQVEFQINIITKPGKPEGPLE 4492
                   |.:||:     .|.|..|  ..|.|.|:::|.|..|..:....|.::.:||.|.||:.
 Frog 26792 -------LRFNTETTAESVIINLKESVASDAGKYELTASNSSGTTKANINIVVLDRPGPPVGPVI 26849

  Fly  4493 VSEVHKDGCKLKWKKPKDDGGEPVESYLVEKFDPDTGIWLPVGRSDGPE-YNVDGLVPGHDYKFR 4556
            :|:|.:|...|:|:.|..|||..|.:|:|.|.:..|..|..|..:.... ..|..|..|.:|:||
 Frog 26850 ISDVTEDSVTLQWEPPSYDGGSQVTNYIVLKRETSTAAWSEVSSTVARNTTRVMKLTKGEEYQFR 26914

  Fly  4557 VKAVNKEGESEPLETLGSIIAKDPFSVPTKPGVP------------------------------- 4590
            :||.|:.|.|:.::: ..:..|.|:::|..|..|                               
 Frog 26915 IKAENRFGISDHIDS-QCVTVKLPYTIPGPPSTPWVSMVTRESITVGWHEPVSNGGSAVIGYHLE 26978

  Fly  4591 -------------------------------------------------------------EP-- 4592
                                                                         ||  
 Frog 26979 MKDRNSILWQKANKTIIRTSHLKVTNISAGLIYEFRVYAENAAGIGKASHPCEPVLAIDACEPPR 27043

  Fly  4593 ----TDWTANKVELAWPEPASDGGSPIQGYIVEVKDKYSPLWEKALETNSPTPTATVQGLIEGNE 4653
                ||.:...|.|||.:||.||||.|.|||||.:|..:..|.||..||.......|.||.:..:
 Frog 27044 NVHVTDISKASVSLAWQKPAYDGGSKITGYIVEKRDLPNGRWTKASFTNVIETQFIVSGLTQSAQ 27108

  Fly  4654 YQFRVVALNK-GGLSEPSDPSKIFTAKPRYLAPKID--RRNLRNITLSSGTALKLDANITGEPAP 4715
            |:|||.|.|. |.:|.|||.:...|....|.||:||  ......:...:|.|:||...|:|:|.|
 Frog 27109 YEFRVFAKNAVGSISNPSDVAGPVTCVDTYGAPQIDLPPEYTDVVKFKAGAAVKLKVGISGKPFP 27173

  Fly  4716 KVEWKLSNYHLQSGKNVTIETPDYYTKLVIRPTQRSDSGEYLVTATNTSGKDSVLVNVVITDKPS 4780
            .:||..:...:::...|::|....:..::|:...|.:||.|.:...|..|..|..:.|.:.|||.
 Frog 27174 TIEWFKNGKEIETSAQVSVENTTEFASVLIKDASRINSGHYELKLKNAMGAASASIRVQMLDKPG 27238

  Fly  4781 PPNGPLQISDVHKEGCHLKWKRPSDDGGTPIEYFQIDKLEPETGCW-IPSCRSTEPQVDVTGLSP 4844
            ||.|.:|...:..|.....|:.|:||||..:.::.::|.|.....| :.|.:..|..:.||.|..
 Frog 27239 PPAGLIQFKTITAEKVTFSWEPPADDGGAVVTHYIVEKRETSRVVWSLVSEKHEESLITVTKLIK 27303

  Fly  4845 GNEYKFRVSAVNAEG-----ESQPLVGDESIV--------------------------------- 4871
            ||||.|||..||..|     ||:|::...:.|                                 
 Frog 27304 GNEYIFRVRGVNKYGIGDPLESEPVIAKNAFVTPGPPSVPEVAMITKTTMTVTWNRPTVDGGSDI 27368

  Fly  4872 --------------------------------------------------------------ARN 4874
                                                                          |.:
 Frog 27369 NGYYLEKRDKKSLRWFKVVKESIRDTRQKVIGLTEGGEYQYRACAINAAGQGPFSDASDYYKAAD 27433

  Fly  4875 PFDEPGKPENLKATDWDKDHVDLAWTPPLIDGGSPISCYIIEKQDKYGKWERALDVPADQCKAT- 4938
            |.|:||:|..||..|..|..:.|.||.|:.||||.|:.|.:|.::: |..|..:.....:.:.| 
 Frog 27434 PIDKPGQPTKLKIVDSTKSSITLNWTKPVYDGGSHITSYAVEAREE-GSEEWTVVSAKGEVRTTE 27497

  Fly  4939 --IPDLVEGQTYKFRVSAVNAAGTGEPSDSTPPIIAKARNKPPIID-----RSSLVEVRIKAGQS 4996
              :..|..|..|.|||||||:||.|||.:.|.|..||...:.|.||     |:|:|   .|||:.
 Frog 27498 FVVSLLKTGVNYFFRVSAVNSAGKGEPIEMTEPAQAKDILEEPEIDLDVALRTSIV---AKAGED 27559

  Fly  4997 FTFDCKVSGEPAPQTKWLLKKKEVYSKDNVKVTNVDYNTKLKVNSATRSDSGIYTVFAENANGE- 5060
            ........|.|||...|...:|.:.|.....:.|.:.:|.:.:...||:|:|.|.:..||..|: 
 Frog 27560 VQIMIPFKGRPAPSVTWRKGEKNISSDPRYNIQNTESSTLVDIPQVTRNDTGKYVLTIENGVGQP 27624

  Fly  5061 DSADVKVTVIDKPAPPNGPLKVDEINSESCTLHWNPPDDDGGQPIDNYVVEKLDETTGRWIPAGE 5125
            .|..|.|.|:|.|:... .|::..|:..:.||.|.||..:||..:.|||:||.|.|...| .|..
 Frog 27625 KSTFVTVKVLDTPSECQ-KLQLKNISRGTVTLVWEPPLINGGAEVTNYVIEKRDATKRAW-AAVT 27687

  Fly  5126 TDGPVTALKVGGLTPGHKYKFRVRAKNRQGTSEPLTTAQAIIAKNPFDVPTKPGTPTIKDFDKEF 5190
            |....|:.|:.||:....:.|||.|:|..|..||..||:.:.|.   :||......|:||..|..
 Frog 27688 TKCSNTSFKITGLSEKTSFFFRVLAENENGLGEPAETAEPVKAS---EVPGPIRDLTMKDSTKTS 27749

  Fly  5191 VDLEWTRPEADGGSPITGYVVEKRDKFSPDWEKCAEISDDITNAHVPDLIEGLKYEFRVRAVNKA 5255
            |.|.|::|:.||||.:|.|::|.:.|.:.:|.. |.||....| .|..|.|....||||.|.|:.
 Frog 27750 VTLSWSKPDYDGGSIVTEYIIESKLKDTQEWSH-ASISKVCEN-EVTKLKELSVVEFRVAAKNEK 27812

  Fly  5256 GPGSPSDATETHVARPKN---TP-PKIDRNFMSDIKIKAGNVFEFDVPVTGEPLPSKDWTHEGNM 5316
            |   .||...|.....|:   || ..|.......|.::.|:....::|..|:|.|:..|..:...
 Frog 27813 G---LSDWVHTAPITVKDYVITPEADISEIVGGQITVRIGHNVHIELPYKGKPRPTISWLKDNIP 27874

  Fly  5317 IINTDRVKISNFDDRTKIRILDAKRSDTGVYTLTARNINGTDRHNVKVTILDAPSVPEGPLRNGD 5381
            :..:::|:....:.:..:.|.:.|:.:.|.|||...|:.....:.:.|..|..||.|:||:|..:
 Frog 27875 LKESEQVRFKKTESKLSLNIKNVKKENGGKYTLILDNLVSRKSYAITVITLGPPSKPKGPVRFDE 27939

  Fly  5382 VSKNSIVLRWRPPKDDGGSEITHYVVEKMDNEAMRWVPVGDCTD---TEIRADNLIENHDYSFRV 5443
            :..:||::.|..|:|:||.|||.|.:||.:.....|..|  |:.   |..:..||::..:|.|||
 Frog 27940 IKADSIIMSWDAPEDNGGGEITSYSIEKRETSQTNWKMV--CSSVARTTFKIPNLVKGTEYQFRV 28002

  Fly  5444 RAVNKQGQSQPLTT--------------------------------------------------- 5457
            :|.|:.|.|.||.:                                                   
 Frog 28003 KAENRYGVSPPLNSVDVIAKHQFRPPGPPGKPVVYNITSDGMTISWDAPIYDGGSEITGFHVEKK 28067

  Fly  5458 -----------SQPITAKD-------------------------PYSHP----------DKPGQP 5476
                       :.|::.::                         |.|.|          |.||.|
 Frog 28068 ERNSILWQRVNTSPVSNREYRITGLIEGLDYQFRVLAENNAGLSPVSEPSKFTLAVSPVDPPGTP 28132

  Fly  5477 QATDWGKHFVDLEWSTPKRDGGAPISSYIIEKRPKFGQWERAAVVLGDNCKAHVPELTNGGEYEF 5541
            ...|..:..|.|:|:.|.||||:.|.:|.||||....:|.|........|:..|..|:.|..:||
 Frog 28133 DYIDVTRETVTLKWNPPLRDGGSKIVAYSIEKRQGKDRWLRCNFTDVSECQYTVTGLSPGDRFEF 28197

  Fly  5542 RVIAVNRGGP-SDPSDPSSTIICKPRFLAPF--FDKSLLNDITVHAGKRLGWTLPIEASPRPLIT 5603
            |:||.|..|. |.||..|..|:.:...:.|.  |.......:||.||:.:.....|:..|.|.:.
 Frog 28198 RIIARNAVGTISPPSQSSGYIMTRDESIFPSIEFGPEHFEGLTVKAGESIRVKALIKGRPVPQVV 28262

  Fly  5604 WLYNGKEIG-------SNSRGESGLFQNELTFEIVSSLRSDEGRYTLILKNEHGSFDASAHATVL 5661
            ||.:||||.       |...|.|.:|..:.:       |...|.|::..||..|:........|.
 Frog 28263 WLKDGKEIDKKMNIEVSGGIGYSSIFVRDAS-------RDHRGVYSVEAKNSSGTKKEDMTIRVQ 28320

  Fly  5662 DRPSPPKGPLDITKITRDGCHLTWNVPDDDGGSPILHYIIEKMDLSRSTWSDAGMSTHIVHD--- 5723
            |.|....||:..:.|:.:...|.|..|.:||.:.|.||:|||.:.||.:|:       :|.|   
 Frog 28321 DTPGQCGGPIRFSNISGEKLTLWWEPPANDGCAAITHYVIEKRETSRLSWA-------LVEDNCE 28378

  Fly  5724 -----VTRLVHRKEYLFRVKAVNAIGESDPLEAVNTIIAKNEFDEPDAPGKPIITDWDRDHIDLQ 5783
                 |::|:...||.||:.|.|..|...||:: ..:.|:.::..|||||.|..|....|.|.:.
 Frog 28379 ACSYTVSKLIKGNEYQFRISAANKFGTGRPLDS-EAVTAQIQYTVPDAPGVPDSTHVTGDSITVT 28442

  Fly  5784 WAVPKSDGGAPISEYIIQKKEKGSPYWTNVRH--------------VPSNK-------------- 5820
            ||.||||||..|..||::::||.|..|..|..              |..|:              
 Frog 28443 WARPKSDGGNEIKHYILERREKKSLRWVKVSSKKPITETRFRVTGLVEGNEYEFRVMAENAGGIG 28507

  Fly  5821 ---------------------------NTT----------------------------------- 5823
                                       :||                                   
 Frog 28508 EASGISRLIKCKEPVNPPSAPSIVKVTDTTKTSVSLEWTKPAFDGGMEIIGYIIDMCKADLGEWH 28572

  Fly  5824 ------------TIPELTEGQEYEFRVIAVNQAGQSEPSEPSDMIMAKPRYLPPKIITPLNEVR- 5875
                        |:.:|..||||:|||.|||.||:.:..|....:....|...|:|....|..: 
 Frog 28573 KVNAEAVVATKYTVVDLEAGQEYKFRVSAVNGAGKGDSCEVPATVQTADRLTSPEIDIDANFKQT 28637

  Fly  5876 --IKCGLIFHTDIHFIGEPAPEATWTLNSNPLLSNDRSTITSIGHHSVVHTVNCQRSDSGIYHLL 5938
              ::.|......|.|.|.|.|.||||...:.|  :.|:.|.:....|.:...:|.|.|:|.|.|.
 Frog 28638 HIVRAGASIRLFIAFKGRPTPTATWTKPDSDL--SLRADIQTTDSFSTLTVEDCNRYDAGKYTLT 28700

  Fly  5939 LRNSSGIDEGSFELVVLDRPGPPEGPMEYEEITANSVTISWKPPKDNGGSEISSYVIEKRDLTHG 6003
            :.|:||....:|.:.|||.|||| ||:.::::|..|:|:.|..|.::||:.|..||:.:|:.:. 
 Frog 28701 VENNSGSKAITFTVKVLDSPGPP-GPITFKDVTRGSITLLWDAPLNDGGARIHHYVVSRREASR- 28763

  Fly  6004 GGWVPAVNYVSAKYNHAV--VPRLLEGTMYELRVMAENLQGRSDPLTSDQPVVAKSQYTVPGAPG 6066
            ..|    ..||.|....:  |..|.||..|..||.|||..|..:|..:.:|.||..:   |..|.
 Frog 28764 RSW----QVVSEKCTRQIIKVTDLGEGLPYFFRVSAENEYGVGEPYETQEPTVATEE---PALPK 28821

  Fly  6067 KPELTDSDKNHITIKWKQPISNGGSPIIGYDIERRDVNTGRWIKINGQPVPTAEYQDDRVTSNHQ 6131
            :.::.|:.|..:::.|.:|..:|||.|..|.||.:...:..||:.....:.|...  :.:|.|.:
 Frog 28822 RLDIIDTSKTSVSLAWLKPDHDGGSRISSYLIEMKQKGSDHWIEAGQTKLLTLTI--NNLTENTE 28884

  Fly  6132 YQYRISAVNAAGNGKTSEPSAIFNARPLRE---KPRFYFDGLIGKRIKVRAGEPVNLNIPISGAP 6193
            |::|:.|.|.||   .|||...|::..::|   :|.....|:..:.|..:||....::|||||.|
 Frog 28885 YEFRVRAKNDAG---YSEPREAFSSVIIKEPQIEPTADLSGITRQHITCKAGNNFTIDIPISGRP 28946

  Fly  6194 TPTIEWKRGDLKLEEGKRISYETNSERTLFRIDDSNRRDSGKYTVTAANEFGKDTADIEVIVVDK 6258
            .|.:.||..:::|:|..|.:.:|..:||...:.||.|.|||:|.:|..|..|..|..:.|.|:.:
 Frog 28947 VPKVTWKLEEMRLKETDRFNIKTTKDRTTLTVKDSMRGDSGRYYLTLENTAGVKTFTVTVTVIGR 29011

  Fly  6259 PSPPEGPLSYTETAPDHISLHWYSPKDDGGSDITGYIIEFTEFGVDDWKPVPGTCPNTNFTVKNL 6323
            |....||:..:..:.:...|:|..|:||||:|||.||:|..|.|..:|:.|..:...|...|.:|
 Frog 29012 PGQVTGPIEVSSVSAESCVLNWAEPEDDGGTDITNYIVERRESGTTNWQLVNSSVKRTQIKVTHL 29076

  Fly  6324 VEGKKYVFRIRAENIYGASEALEGKPVLAKSPFDPPGAPSQPTISAYTPNSANLEWHPPDDCGGK 6388
            |:..:|.||:.|||.:|.|:.||..|::|:.||.||..|::|.:.:.:.|:..:.|..|...||.
 Frog 29077 VKYMEYTFRVSAENRFGVSKPLESSPIVAEHPFVPPSPPTRPEVYSVSNNAIGIRWEEPYHDGGS 29141

  Fly  6389 PITGYIVERRERGG-EWIKCNNYPTPNTSYTVSNLRDGARYEFRVLAVNEAGPGHPSKPSDPMTA 6452
            .:|||.:|::||.. .|:|.|..|....:|.|:.|.:|..|:||..|:|.||....|:.|.|:.|
 Frog 29142 KVTGYWIEKKERNTILWVKDNKLPCFECNYKVTGLVEGLEYQFRAYALNAAGVSKASEASRPVMA 29206

  Fly  6453 EHQRYRPDPPEPPKPDRITRNGVTLSWRPPRTDGKSRIKGYYVEMRPKN----GKDWKTVNDIPI 6513
            ::.   .|||..|:...:||:.|:|||..|..||.|:|.||.||.:|.|    |: |...|...:
 Frog 29207 QNP---VDPPGKPEVTDVTRSSVSLSWSTPLYDGGSKIVGYIVERKPYNETGDGR-WLKCNYTTV 29267

  Fly  6514 NSTVYTVPSLKEGEEYSFRVVAENEVG-RSDPSKPSQPITIEEQPNKPCMELGK--VRDIVCRAG 6575
            :..|:||.:|.|||.|.|||:|:|..| .|.||:.:..:|.:::.:.|..:|..  ..|:..|||
 Frog 29268 SENVFTVTALSEGEAYEFRVLAKNAFGVISAPSQSTGEVTCKDEYSPPKADLDSRLQGDVTIRAG 29332

  Fly  6576 DDFSIHVPYLAFPKPNAFWYSNDNMLDDNNRVHKHLTDDAASVVVKNSKRADSGQYRLQLKNTSG 6640
            .|..:.......|:|..||...|..|:...::....|...|..:||...|:|||:|.|.:||.||
 Frog 29333 SDLVLDASIGGKPEPKVFWSKGDKELELCEKISLQYTSKRAVAIVKFCDRSDSGKYTLTVKNASG 29397

  Fly  6641 FDTATINVRVLDRPSP-PTRLRADEFSGDSLTLYWNPPNDDGGSAIQNYIIEKKEARSSTWSKVS 6704
            ..||::.|:|||.|.| ..::.....:.:..||.|..|.:|||:||.:||:|::|.....|:.|.
 Frog 29398 TKTASVLVKVLDTPGPCADKITISRITDEKCTLSWKLPQEDGGAAISHYIVERRETSRLNWAIVD 29462

  Fly  6705 SFCTVPFVRIRNLVLNKEYDFRVIAENKYGQSDPANTSEPILARHPFDIPNTPGIPHGIDSTEDS 6769
            ..|......:..|:.|.||.||:.|.||||...|.. ||.|:||:.|.||:.||.|..|..::|.
 Frog 29463 PECPTLSCNVTRLIKNNEYIFRLRAVNKYGPGVPLE-SEAIIARNSFTIPSPPGAPEAIGVSKDH 29526

  Fly  6770 ITIAWTKPKHDGGSPITGYIIEKRLLSDDKWTK-----AVHALCPDLSCKIPNLIENAEYEFRVA 6829
            :.|.|.||:.||||.|:.||::||.....:||:     .::    |...||.:|:|.:||:|||:
 Frog 29527 VIIQWLKPESDGGSEISTYIVDKREKKSVRWTRVNKDYTIY----DTRLKITSLLEGSEYQFRVS 29587

  Fly  6830 AVNAAGQSAYSGSSDLIFCRRP---PHAPKI--------TS------------------------ 6859
            ||||||.|..|.||..:.|:.|   |.||.|        ||                        
 Frog 29588 AVNAAGNSEPSDSSPYVLCKEPTYTPAAPSIPRVEDTTKTSISLAWSKPLYDGGADIVGYVLEMR 29652

  Fly  6860 ---------------------------------------------------------------DL 6861
                                                                           ||
 Frog 29653 EDGTEQWYRPHTTATLRNLEFTVTGLKANHKYTFRVASVNANGMSDFSEASGIIEPVERIEVPDL 29717

  Fly  6862 SIRD-----MTVIAGDEFRITVPYHASPRPTASWSLNGLEVI----------------------- 6898
            .:.|     :||.||...|:.|.....|.|..:|...|:::.                       
 Frog 29718 ELADDLKKIVTVRAGGSLRLMVSVSGRPSPVITWRKEGVDLASRAMIDITDSYTLLVVEKVNRYD 29782

  Fly  6899 --------------------------PG-------ERIKFDS----------------NDY---- 6910
                                      ||       :.:..||                |:|    
 Frog 29783 AGKYIIEAVNQSGKKSATVVVKVYDSPGPCGAVTVKEVSRDSATITWDVPALDGGAPVNNYIIER 29847

  Fly  6911 ---------------------------ASMYY--------------------------------- 6915
                                       ..|||                                 
 Frog 29848 REAAMRAFKTVTTKCNKTLYRITGLTEGLMYYFRVLPENIYGIGEPCETADAILVSEVPMVPQKL 29912

  Fly  6916 ----------------------------------------------------------------- 6915
                                                                             
 Frog 29913 EVTDVTKSTVSLAWEKPLHDGGSRLTGYVIEACRAGTDKWMKVATLKPGAFDYTITSLNEGEQYL 29977

  Fly  6916 ----------------------------------------------------------------- 6915
                                                                             
 Frog 29978 FRVRAQNQKGVSEPREIVTAVTVQDQKVLPSIDLAGIPQKTVHVPAGRPIELAIPIHGRPPPAVS 30042

  Fly  6916 -------------------NKSAK---RD----ETGSYTITLTNNKGSDTASCHVTVVDRPLPPQ 6954
                               ||.||   |:    :||.||:.:.|..|:......|.::|:|.||.
 Frog 30043 WFFAGSKIKEVDRVKIETVNKVAKLTIRETTIHDTGDYTLEVKNATGTVAEVIKVVILDKPGPPT 30107

  Fly  6955 GPL-------------------------------------------------------------- 6957
            ||:                                                              
 Frog 30108 GPVTIDEVDASSVSVSWEAPLMDGGATISGYVVEQRDAHRPGWLPVSESVTRTMYKFNRLTEGTE 30172

  Fly  6958 -------------------------------------NAYDITPDTCTLAWKTPLDDGGSPITNY 6985
                                                 ..:|::.|..|:.|..|.:||||.:|.|
 Frog 30173 YVFRVAATNRFGIGSYLQSEVVECKSRISIPGPPETPQVFDVSRDGMTITWNPPDEDGGSQVTGY 30237

  Fly  6986 VVEK------------------------------------------------------------- 6989
            :||:                                                             
 Frog 30238 IVERKEVRADRWVRANKVPVTMTRYRSTGLIEGLEYEHRVTAINARGDGKPSRSSKPAVAMDPIA 30302

  Fly  6990 ----------------------------------------------------------------- 6989
                                                                             
 Frog 30303 PPAKPQNPRVTDTTRTSVSLAWSPPEEEGGSKVTGYLIEMQKVDQYEWTKCNTTPTKICEYTLTH 30367

  Fly  6990 ----------------------------------------------------------------- 6989
                                                                             
 Frog 30368 LPQGAEYRFRLMACNAGGPGEPADVPGTVKITEMLEYPDYELDEKYQDGLTVRQGGAIRISIPIK 30432

  Fly  6990 ----------------------------------------------------------------- 6989
                                                                             
 Frog 30433 GKPIPICKWTKEGRDVSKRAMIATSETHTELVIREAVREDTGTYDLMLENKCGKKAVYIKVKVIG 30497

  Fly  6990 --------------------------LDNSGS----------------WVKISSFVRNTHYDVMG 7012
                                      .|:.||                |..:.|.|:.|...|.|
 Frog 30498 SPDTPEGPLEYDDIQTRSVRVSWRAPADDGGSDILGYIVERREVPKTAWYTVDSRVKGTSLVVKG 30562

  Fly  7013 LEPHYKYNFRVRAENQYGLSDPLDIIEPIVAKHQFTVPDEPGQ-PKVIDWDSGNVTLIWTRPLSD 7076
            |:.:.:|:|||.:|||:|:|.||...||.:.|....||:.|.. |:::|....:|:|.|:||..|
 Frog 30563 LKENVEYHFRVSSENQFGVSRPLKSEEPAIPKTPLNVPEPPSNPPEIVDITKSSVSLSWSRPRDD 30627

  Fly  7077 GGSRIQGYQIEYRDILNDSSWNAYDYI-IKDTKYQLYNLINGSEYEFRIKAKNAAGLSKPSSPSL 7140
            ||||:.||.|:.::...: .|..::.. |..|.|.:..|:..:||:|||.|:|..|||:||..|.
 Frog 30628 GGSRVTGYYIDRKESTTE-KWVRHNKTHITTTMYTVTGLVPDAEYQFRIIAQNDIGLSEPSPASD 30691

  Fly  7141 RFKLKGKFTVPSPPGAPQVTRVGKNYVDLKWEKPLRDGGSRITGYIIERRDIGGAVWVKCNDYNV 7205
            ....|..|..||.||..::|.|.|:.:.::||||..|||..|.||.:|.|..|.:.|.|||...:
 Frog 30692 PIICKDPFDKPSQPGDIEITSVSKDSITIQWEKPECDGGKEILGYWVEYRQSGDSAWKKCNKERI 30756

  Fly  7206 LDTEYTVMNLIEMGDYEFRVFAVNSAGRSEPSLCTMPIKVCEVLGGKKPDWITRLQDKVAPFGKD 7270
            .|.::|:..|:|..:|||||.|.|..|.|.|....|.:|. ::..|:.|.....::|.....|:.
 Frog 30757 KDRQFTMGGLLEATEYEFRVSAENETGISRPRRTAMTVKT-KLTSGEAPGLRQEIKDITTKLGES 30820

  Fly  7271 YTLQCAASGKPSPTARWLRNGKE-IQMNGGRMTCDSKDGVFRLHISNVQT---GDDGDYTCEAMN 7331
            ..|.|...|:|.|..:|.|.||| :|....:|:.|.::     |...|||   .|:|.|||.|:|
 Frog 30821 AKLTCQIVGRPLPDIKWYRFGKELVQSRKYKMSSDGRN-----HTLTVQTEEQEDEGLYTCVAVN 30880

  Fly  7332 SLGFVNTSGYLKIGSPPIIN-RCPSELKLPEGDNSKIKI--------------FYSGDQPLTVIL 7381
            ..|.:.|||.|.:.:.|..: ..|.:.|...|..:.:::              || |.:||    
 Frog 30881 DAGEIETSGKLLLEATPQFHPGFPLKEKYFAGVGTTLRLHVAYIGRPVPAITWFY-GKKPL---- 30940

  Fly  7382 KKNNEVICDSNDDTHVKVNIFDDYVAIYIRNIV-KSDGGPYQIEFTNESGSATGEFYVHITGMPS 7445
             |::|         ::.|...:.|..:.|:|:. |:..|.|:::.:|..|:......|.|...|.
 Frog 30941 -KSSE---------NITVETTEHYTHLVIKNVQHKTHAGKYKVQLSNIFGTVDTVLNVEIQDKPD 30995

  Fly  7446 APTGPMGISYINKNSCMLNWRPPSYDGGLKVSHYVIERKDV-SSPHWITVSSTCKDTAFNVQGLI 7509
            .|.||:.:..:.|||.:::|:||..|||..|::||:||::. ....|..|||:...|...:..|.
 Frog 30996 KPAGPIVVDALLKNSVVISWKPPEDDGGSLVTNYVVERREAKEGEEWHLVSSSISGTTCRIVNLN 31060

  Fly  7510 ENQEYIFRVMAVNENGMGPPLEGLNPIRAKDPIDPPSPPGSPQITEIGGDFVHLEWEKPESDGGA 7574
            ||..|.|||.|.|..|:...||..:.:..|.|.:.|..|..|.:|.:..|...:.|:.|.|||||
 Frog 31061 ENAGYYFRVSAQNLYGISEALEIPSIVVIKSPFEKPGVPAQPIVTAVTKDSCVVSWKPPASDGGA 31125

  Fly  7575 HIQGYWIDKREVGSNTWQRVNATICAANQINCINLIEGRQYEFRIFAQNVAGLSTESSASQAVKI 7639
            .|..|:::|||...|.|..|..........:...||||.:||||:..:|:.|.|..|..|:.:..
 Frog 31126 KITNYYLEKREKKQNKWISVTTEEIRETVYSVKGLIEGLEYEFRVKCENLGGESEWSEVSEPIVP 31190

  Fly  7640 IDPQAASPPLIVKPLRDANCIQNHNAQFTCTINGVPKPTISWYKGAREI-SNGARYHMYS-EGDN 7702
            ....|...|...:.||:.|......|.|.|.:.|.|||.:.|:|..:|| .:|.:..:.. :|..
 Frog 31191 KSDVAIRAPQFKEELRNLNVKYRSTATFVCKVIGHPKPVVKWFKQGKEILPDGEKVKLQEFKGGY 31255

  Fly  7703 HFLNINDVFGEDADEYVCRAVNKAGAKSTRATLAIMTAPKLNVPPRFR--DTAYFDKGENVVIKI 7765
            :.|.|.:...:||..|..||.|:.|:.|..|:|.:....|:::|....  ...:..:||.|.|||
 Frog 31256 YQLVITNSSEDDATVYQVRATNQGGSISATASLDVEVPAKIHLPKHLEGMGAVHALRGEIVSIKI 31320

  Fly  7766 PFTGFPKPRIHWVRDGENIESGGHYTVEVKERHAVLIIRDG-SHLDSGPYRITAENELGSDTAII 7829
            ||:|.|.|.|.|.:..:.|::.|.|.|.|......|:..:| ...|:|.|.:.|:|..|.|...:
 Frog 31321 PFSGKPDPVITWQKGQDLIDNNGQYQVIVTRSFTSLVFSNGVERKDAGFYVVCAKNRFGIDQKTV 31385

  Fly  7830 QVQISDRPDPPRFPLIESIGTESLSLSWKAPVWDGCSDITNYYVERREHPLSSWIRVGNTRFTSM 7894
            ::.::|.|||||...:..|..:|::|:|..|..||.|.|.||.:|:.......||||...|.|..
 Frog 31386 ELDVADVPDPPRGIKVSDISRDSVNLTWNPPATDGGSKIINYIIEKCATTSERWIRVAQARETRY 31450

  Fly  7895 AVSGLTPGKEYDFRIFADNVYGRSDASDTSTLIKTKESVKKKPIERKWEIDANGRKLRGKADGPV 7959
            .|..|.....|.||:.|:|.:|:|..|:.:..|.|||.                 |.|      :
 Frog 31451 TVVNLFGKTRYQFRVIAENKFGQSKPSEPTDPIVTKED-----------------KTR------M 31492

  Fly  7960 KDYDSYVFDI-YSKFVPQPVEISQQSVYDRYDILEEIGTGAFGVVHRCRERSTGNIFAAKFIPVS 8023
            .:||..|.:| .||  .:.|..|.:.:::::.|.||:|.|.||:||||.|.|:...:.|||:.|.
 Frog 31493 LNYDDEVTEIEISK--TKAVHSSTKVLHEKFSIAEELGHGQFGIVHRCIENSSKKTYLAKFVKVK 31555

  Fly  8024 HSVEKDLIRREIDIMNQLHHQKLINLHDAFEDDDEMILILEFLSGGELFERITAEGYVMTEAEVI 8088
             ..::.|:::||.|:|...|:.|:.||::||..:|:::|.||:||.::|||::..|:.:.|.|::
 Frog 31556 -GADQVLVKKEISILNVARHRNLLYLHESFESLEELVMIFEFISGSDIFERLSVAGFELCEREIV 31619

  Fly  8089 NYMRQICEGIRHMHEQNIIHLDIKPENIMCQTRSSTNVKLIDFGLATRLDPNEVVKITTGTAEFA 8153
            :|:||:||.:..:|..:|.|.||:||||:..||.|:.:|:.:||.|.:|.|.:..:|.....|:.
 Frog 31620 SYVRQVCEALEFLHANSIGHFDIRPENIIYTTRRSSTIKITEFGQARQLIPGDSFRIQFSAPEYY 31684

  Fly  8154 APEIVNREPVGFYTDMWATGVLSYVLLSGLSPFAGDNDVQTLKNVKACDWDFDVESFKYISEEAK 8218
            |||:...:.|...||||:.|.|.|||||||:|||.:.:.|.::|:...:::|:.|:||.:|.||.
 Frog 31685 APEVHQHDLVSSATDMWSLGTLVYVLLSGLNPFAAETNQQMIENITNAEYNFEDEAFKDVSLEAL 31749

  Fly  8219 DFIRKLLVRNKEKRMTAHECLLHPWLTGDHSAMKQEINRD-RYLAYREKLRRKYEDFERFLLPIG 8282
            |||.:|:::.::.||||.|.|.|.||......:..::.:. |:..|.:.|.:|..:   |.:.:.
 Frog 31750 DFIDRLIIKERKARMTAAEALEHSWLKQKTEKVSTKVIKTLRHRRYYQTLIKKEWN---FAVSVA 31811

  Fly  8283 RLSEYSSLRK---LLMEKYKIHDAVFDRRQAAPRFVIRP-SSQFCY----EGQSVKFYCRCIAIA 8339
            |:....::|.   :.:.|.|:           ....|.| :.|..:    ||...||.|:.....
 Frog 31812 RICNGGAIRSQKGVTVAKVKV-----------ASIEIGPVTGQITHAVGEEGGYAKFSCKIENYD 31865

  Fly  8340 TPT-LTWSHNNIELRQSVKFMKRYVGDDYYFIINRVKLDDRGEYIIRAENHYGSREEVVFLNVQP 8403
            ..| :||.....:|..|.|:...|...:....:..:...|.|.|..:..|.||.......|.|:.
 Frog 31866 QSTEVTWYFGIRQLENSDKYEITYNEGNASIYVKDISKSDDGTYRCKVVNDYGEDSSYAELFVKG 31930

  Fly  8404 LPKEQPRYRTEST-PVRRREPLPYTFWQEESETAPSFTFLLRPRVMQARDTCKLLCCLSGKPVPN 8467
            :.::...||..:. .|:||...     ....|..|.||..|..|.....:..:....::..|.|:
 Frog 31931 VREQNDHYRCRTVKKVKRRVDA-----MRLLERPPEFTLPLFNRTAYIGENIRFGVTITVHPDPH 31990

  Fly  8468 VRWYKDGRELSKYEYAMTHSDGVVTMEIIDCKPSDSGKYSCKATNCHGTDETDCVVIVEGEWVTP 8532
            |.|.|.|:::...|     .:...|.|      ||.|.|..                        
 Frog 31991 VTWLKSGQKIKPGE-----DEKKYTFE------SDKGLYQL------------------------ 32020

  Fly  8533 EQAQLAHNFLYSGDRKYIEQPIKPAPLPIVTSRQYTSSSVQNTSEPQGDKVNVSNSNSSGISNKK 8597
                :.||.....|.:|.                                          ::.|.
 Frog 32021 ----IIHNLTTDDDAEYT------------------------------------------VAAKN 32039

  Fly  8598 KYASNSLQAPGSPSRSRSATKELILP----PDDSLMCKPEFTKPLHDLTIHDGEQLILTCYVKGD 8658
            ||..:|.:|           |..::|    .|::|  :|.|.:.|.:....:|:.:.....|.|.
 Frog 32040 KYGEDSCKA-----------KLTVIPHPAAADNTL--RPMFKRLLANAECQEGQSVRFEIRVSGT 32091

  Fly  8659 PEPQISWSKNGKSLSSSDILDLRYKN-GIATLTINEVFPEDEGVITCTATNSVGAVETKCKLTIQ 8722
            |:|.:.|.|:|::|:....:::.::. ....|.|.:..|||.|....|||||.|:...:..|.::
 Frog 32092 PKPTLKWEKDGQALALGPNIEIIHEGLDYFALFIRDTLPEDSGYYRVTATNSAGSTSCQAYLKVE 32156

  Fly  8723 PLD------KNINKRKVNAGDNAPKIVSHLESRFVRDGDAVNL------ACRIIGAQHFDVVWLH 8775
            .:.      |:..:|||:......|.:...|  .:...|:|.|      |.|       :..:|:
 Frog 32157 RMRYVKREFKSEEERKVHVQKQIDKTLRMAE--ILSGADSVPLTPVAQQALR-------EAAFLY 32212

  Fly  8776 ----NNKEIKPSKDFQ---YTNEANIYRL 8797
                :.|.:|...|.:   ...||.:.|:
 Frog 32213 KPAVSTKTVKGEYDIKKEVIKKEAKVIRM 32241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btNP_001162825.1 I-set 9..101 CDD:254352 29/146 (20%)
Ig 26..100 CDD:143165 27/128 (21%)
I-set 119..210 CDD:254352 15/95 (16%)
Ig 136..209 CDD:143165 10/72 (14%)
I-set 228..320 CDD:254352 20/106 (19%)
IGc2 242..312 CDD:197706 14/81 (17%)
I-set 335..425 CDD:254352 20/103 (19%)
Ig 350..423 CDD:143165 16/83 (19%)
Ig 436..530 CDD:299845 18/111 (16%)
I-set 438..532 CDD:254352 18/111 (16%)
I-set 545..636 CDD:254352 18/107 (17%)
Ig 560..633 CDD:143165 13/77 (17%)
Ig 657..731 CDD:143165 18/74 (24%)
I-set 746..835 CDD:254352 22/102 (22%)
Ig 1496..1586 CDD:299845 25/92 (27%)
IG_like 1503..1588 CDD:214653 23/87 (26%)
I-set 1639..1724 CDD:254352 8/84 (10%)
IG 1750..1821 CDD:214652 8/70 (11%)
IGc2 1750..1806 CDD:197706 8/55 (15%)
I-set 1826..1909 CDD:254352 16/105 (15%)
Ig 1831..1897 CDD:299845 11/80 (14%)
I-set 1914..1998 CDD:254352 15/107 (14%)
Ig 2020..2095 CDD:299845 26/97 (27%)
FN3 2100..2194 CDD:238020 35/95 (37%)
FN3 2203..2292 CDD:238020 38/113 (34%)
I-set 2311..2395 CDD:254352 26/86 (30%)
Ig 2321..2395 CDD:299845 23/76 (30%)
FN3 2399..2493 CDD:238020 30/93 (32%)
FN3 2501..2590 CDD:238020 32/88 (36%)
I-set 2602..2693 CDD:254352 24/90 (27%)
Ig 2619..2693 CDD:299845 21/73 (29%)
FN3 2697..2793 CDD:238020 35/95 (37%)
FN3 2801..2893 CDD:238020 40/190 (21%)
I-set 2902..2995 CDD:254352 27/99 (27%)
Ig 2919..2993 CDD:299845 19/73 (26%)
FN3 2999..3088 CDD:238020 34/88 (39%)
FN3 3102..3191 CDD:238020 34/97 (35%)
I-set 3208..3292 CDD:254352 27/95 (28%)
Ig 3219..3292 CDD:299845 22/72 (31%)
FN3 3296..3390 CDD:238020 32/93 (34%)
FN3 3400..3489 CDD:238020 36/93 (39%)
I-set 3494..3590 CDD:254352 23/95 (24%)
Ig 3516..3590 CDD:299845 19/73 (26%)
FN3 3594..3682 CDD:238020 37/188 (20%)
FN3 3694..3781 CDD:238020 35/95 (37%)
I-set 3795..3885 CDD:254352 24/89 (27%)
Ig 3813..3885 CDD:299845 21/71 (30%)
FN3 3889..3980 CDD:238020 35/91 (38%)
FN3 3990..4082 CDD:238020 36/191 (19%)
I-set 4090..4181 CDD:254352 26/98 (27%)
Ig 4108..4181 CDD:299845 20/78 (26%)
FN3 4185..4271 CDD:238020 29/86 (34%)
FN3 4285..4383 CDD:238020 40/104 (38%)
Ig 4404..4480 CDD:299845 24/82 (29%)
FN3 4484..4571 CDD:238020 32/87 (37%)
FN3 4584..4677 CDD:238020 43/191 (23%)
I-set 4685..4775 CDD:254352 24/91 (26%)
Ig 4703..4775 CDD:299845 19/71 (27%)
FN3 4779..4863 CDD:238020 32/89 (36%)
FN3 4879..4970 CDD:238020 37/93 (40%)
IG 4989..5069 CDD:214652 23/80 (29%)
Ig 4996..5069 CDD:299845 20/73 (27%)
FN3 5073..5166 CDD:238020 34/92 (37%)
FN3 5175..5265 CDD:238020 34/89 (38%)
I-set 5276..5366 CDD:254352 17/89 (19%)
Ig 5293..5366 CDD:299845 14/72 (19%)
FN3 5370..5462 CDD:238020 36/156 (23%)
FN3 5470..5561 CDD:238020 37/101 (37%)
Ig 5559..5654 CDD:299845 26/103 (25%)
I-set 5570..5660 CDD:254352 25/98 (26%)
FN3 5664..5755 CDD:238020 31/98 (32%)
FN3 5764..5853 CDD:238020 44/190 (23%)
I-set 5865..5954 CDD:254352 27/91 (30%)
Ig 5882..5954 CDD:299845 23/71 (32%)
FN3 5958..6049 CDD:238020 33/92 (36%)
FN3 6062..6153 CDD:238020 27/90 (30%)
I-set 6173..6255 CDD:254352 30/81 (37%)
Ig_Titin_like 6182..6255 CDD:143225 27/72 (38%)
FN3 6259..6350 CDD:238020 34/90 (38%)
FN3 6359..6451 CDD:238020 32/92 (35%)
FN3 6470..6552 CDD:238020 37/86 (43%)
I-set 6564..6650 CDD:254352 29/87 (33%)
Ig_Titin_like 6577..6650 CDD:143225 24/72 (33%)
FN3 6654..6745 CDD:238020 32/91 (35%)
FN3 6754..6840 CDD:238020 38/90 (42%)
I-set 6855..6946 CDD:254352 38/482 (8%)
Ig 6874..6946 CDD:299845 27/363 (7%)
FN3 6950..7042 CDD:238020 41/488 (8%)
FN3 7050..7139 CDD:238020 34/90 (38%)
FN3 7151..7237 CDD:238020 37/85 (44%)
I-set 7254..7334 CDD:254352 27/83 (33%)
Ig 7272..7339 CDD:143165 25/70 (36%)
IG_like 7354..7440 CDD:214653 20/100 (20%)
Ig 7366..7440 CDD:299845 17/88 (19%)
FN3 7444..7531 CDD:238020 33/87 (38%)
FN3 7545..7637 CDD:238020 33/91 (36%)
I-set 7648..7737 CDD:254352 29/90 (32%)
Ig 7665..7734 CDD:143165 23/70 (33%)
Ig 7760..7833 CDD:299845 25/73 (34%)
FN3 7837..7927 CDD:238020 33/89 (37%)
STKc_Twitchin_like 7986..8244 CDD:271016 105/257 (41%)
S_TKc 7989..8244 CDD:214567 105/254 (41%)
Ig 8311..8394 CDD:299845 21/88 (24%)
I-set 8312..8401 CDD:254352 22/94 (23%)
I-set 8437..8525 CDD:254352 18/87 (21%)
Ig 8455..8519 CDD:143165 13/63 (21%)
I-set 8632..8721 CDD:254352 25/89 (28%)
IGc2 8646..8711 CDD:197706 20/65 (31%)
I-set 8740..8831 CDD:254352 14/71 (20%)
Ig 8757..8826 CDD:143165 11/54 (20%)
I-set 8839..8922 CDD:254352
Ig 8845..>8909 CDD:299845
ttnXP_031748776.1 Ig strand F 9644..9652 CDD:409353
Ig strand G 9655..9665 CDD:409353
I-set 9672..9761 CDD:400151
Ig strand B 9689..9693 CDD:409353
Ig strand C 9702..9706 CDD:409353
Ig strand E 9727..9731 CDD:409353
Ig strand F 9741..9746 CDD:409353
Ig strand G 9754..9757 CDD:409353
I-set 9781..9869 CDD:400151
Ig strand A' 9783..9789 CDD:409353
Ig strand B 9796..9803 CDD:409353
Ig strand C 9809..9814 CDD:409353
Ig strand C' 9816..9819 CDD:409353
Ig strand D 9825..9829 CDD:409353
Ig strand E 9834..9841 CDD:409353
Ig strand F 9848..9856 CDD:409353
Ig strand G 9859..9870 CDD:409353
THB 9902..9932 CDD:408162
Ig 9986..10054 CDD:416386
Ig strand B 9997..10004 CDD:409353
Ig strand C 10011..10016 CDD:409353
Ig strand C' 10018..10021 CDD:409353
Ig strand D 10026..10030 CDD:409353
Ig strand E 10035..10042 CDD:409353
Ig strand G 10056..10066 CDD:409353
Ig 10069..10153 CDD:416386
Ig strand B 10085..10091 CDD:409353
Ig strand C 10098..10103 CDD:409353
Ig strand C' 10106..10109 CDD:409353
Ig strand D 10114..10119 CDD:409353
Ig strand E 10122..10127 CDD:409353
Ig strand F 10136..10141 CDD:409353
I-set 10159..10245 CDD:400151
Ig strand B 10175..10179 CDD:409353
Ig strand C 10187..10191 CDD:409353
Ig strand E 10212..10216 CDD:409353
Ig strand F 10226..10231 CDD:409353
Ig strand G 10240..10243 CDD:409353
PTZ00121 <10269..10948 CDD:173412
PspC_subgroup_2 <11039..11370 CDD:411408
Ig 11382..11473 CDD:416386
Ig strand B 11402..11406 CDD:409353
Ig strand C 11415..11418 CDD:409353
Ig strand E 11439..11443 CDD:409353
Ig strand F 11453..11458 CDD:409353
IG 11486..11566 CDD:214652
Ig 11574..11657 CDD:416386
Ig strand A 11751..11753 CDD:409353
Ig 11753..11835 CDD:416386
Ig strand A' 11755..11761 CDD:409353
Ig strand B 11768..11775 CDD:409353
Ig strand C 11780..11784 CDD:409353
Ig strand C' 11786..11789 CDD:409353
Ig strand D 11794..11798 CDD:409353
Ig strand E 11803..11810 CDD:409353
Ig strand F 11817..11825 CDD:409353
Ig strand A 11839..11841 CDD:409353
Ig 11840..11923 CDD:416386
Ig strand A' 11843..11849 CDD:409353
Ig strand B 11856..11863 CDD:409353
Ig strand C 11869..11873 CDD:409353
Ig strand C' 11875..11878 CDD:409353
Ig strand D 11883..11887 CDD:409353
Ig strand E 11892..11899 CDD:409353
Ig strand F 11906..11913 CDD:409353
Ig 11928..12011 CDD:416386
Ig strand B 11944..11950 CDD:409353
Ig strand C 11956..11961 CDD:409353
Ig strand C' 11964..11967 CDD:409353
Ig strand D 11972..11977 CDD:409353
Ig strand E 11980..11985 CDD:409353
Ig strand F 11994..12000 CDD:409353
Ig 12017..12100 CDD:416386
Ig strand B 12033..12040 CDD:409353
Ig strand C 12045..12050 CDD:409353
Ig strand C' 12052..12055 CDD:409353
Ig strand D 12060..12064 CDD:409353
Ig strand E 12069..12076 CDD:409353
Ig strand F 12083..12091 CDD:409353
Ig strand G 12092..12101 CDD:409353
Ig 12107..12181 CDD:416386
Ig strand A' 12111..12116 CDD:409353
Ig strand B 12121..12128 CDD:409353
Ig strand C 12133..12140 CDD:409353
Ig strand C' 12141..12144 CDD:409353
Ig strand D 12150..12155 CDD:409353
Ig strand E 12158..12168 CDD:409353
Ig strand F 12172..12180 CDD:409353
Ig 12195..12278 CDD:416386
Ig 12302..12360 CDD:416386
Ig strand C 12312..12317 CDD:409353
Ig strand C' 12320..12323 CDD:409353
Ig strand D 12328..12333 CDD:409353
Ig strand E 12336..12341 CDD:409353
Ig strand F 12350..12356 CDD:409353
Ig 12373..12456 CDD:416386
Ig 12464..12545 CDD:416386
Ig strand A' 12467..12472 CDD:409353
Ig strand B 12477..12484 CDD:409353
Ig strand C 12491..12496 CDD:409353
Ig strand C' 12497..12500 CDD:409353
Ig strand D 12504..12510 CDD:409353
Ig strand E 12513..12524 CDD:409353
Ig strand F 12528..12536 CDD:409353
Ig 12551..12635 CDD:416386
Ig strand A' 12554..12560 CDD:409353
Ig strand B 12567..12574 CDD:409353
Ig strand C 12579..12584 CDD:409353
Ig strand C' 12586..12589 CDD:409353
Ig strand D 12594..12598 CDD:409353
Ig strand E 12603..12610 CDD:409353
Ig strand F 12617..12625 CDD:409353
Ig strand G 12626..12635 CDD:409353
Ig 12640..12710 CDD:416386
Ig strand A' 12643..12649 CDD:409353
Ig strand B 12656..12663 CDD:409353
Ig strand C 12668..12673 CDD:409353
Ig strand C' 12675..12678 CDD:409353
Ig strand D 12683..12687 CDD:409353
Ig strand E 12692..12699 CDD:409353
Ig strand F 12706..12713 CDD:409353
Ig strand G 12714..12723 CDD:409353
Ig 12735..12805 CDD:416386
Ig strand A' 12736..12740 CDD:409353
Ig strand B 12744..12750 CDD:409353
Ig strand C 12757..12762 CDD:409353
Ig strand C' 12765..12768 CDD:409353
Ig strand D 12773..12778 CDD:409353
Ig strand E 12781..12786 CDD:409353
Ig strand F 12795..12801 CDD:409353
Ig strand A 12816..12823 CDD:409353
Ig 12818..12902 CDD:416386
Ig strand A' 12824..12829 CDD:409353
Ig strand B 12834..12842 CDD:409353
Ig strand C 12845..12851 CDD:409353
Ig strand C' 12853..12855 CDD:409353
Ig strand D 12861..12867 CDD:409353
Ig strand E 12870..12877 CDD:409353
Ig strand F 12886..12893 CDD:409353
Ig strand G 12895..12902 CDD:409353
Ig 12907..12995 CDD:416386
Ig strand A' 12910..12916 CDD:409353
Ig strand B 12923..12930 CDD:409353
Ig strand C 12935..12940 CDD:409353
Ig strand C' 12942..12945 CDD:409353
Ig strand D 12950..12954 CDD:409353
Ig strand E 12959..12966 CDD:409353
Ig strand F 12973..12981 CDD:409353
Ig strand G 12984..12995 CDD:409353
Ig 13001..13084 CDD:416386
Ig strand B 13016..13022 CDD:409353
Ig strand C 13029..13034 CDD:409353
Ig strand C' 13037..13040 CDD:409353
Ig strand D 13045..13050 CDD:409353
Ig strand E 13053..13058 CDD:409353
Ig strand F 13067..13073 CDD:409353
Ig 13091..13173 CDD:416386
Ig strand B 13105..13111 CDD:409353
Ig strand C 13118..13123 CDD:409353
Ig strand C' 13126..13129 CDD:409353
Ig strand D 13134..13139 CDD:409353
Ig strand E 13142..13147 CDD:409353
Ig strand F 13156..13162 CDD:409353
Ig strand G 13165..13173 CDD:409353
Ig 13179..13261 CDD:416386
Ig 13275..13352 CDD:416386
Ig strand A 13275..13278 CDD:409353
Ig strand B 13283..13289 CDD:409353
Ig strand C 13295..13301 CDD:409353
Ig strand D 13310..13315 CDD:409353
Ig strand E 13316..13322 CDD:409353
Ig strand F 13331..13339 CDD:409353
Ig strand G 13342..13352 CDD:409353
FN3 13356..13444 CDD:238020
FN3 13457..13549 CDD:238020
FN3 13558..13646 CDD:238020
Ig 13676..13750 CDD:416386
Ig 6..98 CDD:416386
Ig strand A 6..8 CDD:409353
Ig strand A' 11..16 CDD:409353
Ig strand B 23..31 CDD:409353
Ig strand C 36..40 CDD:409353
Ig strand C' 44..46 CDD:409353
Ig strand D 53..59 CDD:409353
Ig strand E 62..67 CDD:409353
Ig strand F 76..84 CDD:409353
Ig strand G 87..98 CDD:409353
Ig 103..193 CDD:416386
Ig strand A 103..106 CDD:409353
Ig strand A' 109..113 CDD:409353
Ig strand B 121..129 CDD:409353
Ig strand C 134..139 CDD:409353
Ig strand C' 142..144 CDD:409353
Ig strand D 150..155 CDD:409353
Ig strand E 158..163 CDD:409353
Ig strand F 172..180 CDD:409353
Ig strand G 183..193 CDD:409353
Ig 734..824 CDD:416386
Ig strand A 734..737 CDD:409353
Ig strand A' 740..744 CDD:409353
Ig strand B 752..760 CDD:409353
Ig strand C 765..770 CDD:409353
Ig strand C' 773..775 CDD:409353
Ig strand D 781..786 CDD:409353
Ig strand E 789..794 CDD:409353
Ig strand F 803..811 CDD:409353
Ig strand G 814..824 CDD:409353
I-set 869..958 CDD:400151
Ig strand A 869..872 CDD:409353
Ig strand A' 875..880 CDD:409353
Ig strand B 885..892 CDD:409353
Ig strand C 899..905 CDD:409353
Ig strand C' 906..909 CDD:409353
Ig strand D 915..922 CDD:409353
Ig strand E 925..935 CDD:409353
Ig strand F 939..947 CDD:409353
Ig 1071..1159 CDD:416386
Ig strand A' 1075..1080 CDD:409353
Ig strand B 1085..1092 CDD:409353
Ig strand C 1099..1105 CDD:409353
Ig strand C' 1106..1109 CDD:409353
Ig strand E 1124..1134 CDD:409353
Ig strand F 1138..1146 CDD:409353
Ig strand G 1148..1159 CDD:409353
Ig 1218..1308 CDD:416386
Ig strand A 1218..1221 CDD:409353
Ig strand A' 1224..1229 CDD:409353
Ig strand B 1234..1241 CDD:409353
Ig strand C 1248..1254 CDD:409353
Ig strand C' 1255..1258 CDD:409353
Ig strand D 1264..1270 CDD:409353
Ig strand E 1273..1283 CDD:409353
Ig strand F 1287..1295 CDD:409353
Ig strand G 1297..1308 CDD:409353
Ig 1317..1409 CDD:416386
Ig strand A 1317..1319 CDD:409353
Ig strand A' 1321..1327 CDD:409353
Ig strand B 1334..1341 CDD:409353
Ig strand C 1347..1352 CDD:409353
Ig strand C' 1354..1357 CDD:409353
Ig strand D 1364..1368 CDD:409353
Ig strand E 1373..1380 CDD:409353
Ig strand F 1387..1395 CDD:409353
Ig strand G 1398..1409 CDD:409353
Ig strand B 1480..1488 CDD:409353
Ig <1483..1555 CDD:416386
Ig strand C 1495..1501 CDD:409353
Ig strand C' 1504..1506 CDD:409353
Ig strand D 1512..1516 CDD:409353
Ig strand E 1519..1527 CDD:409353
Ig strand F 1535..1542 CDD:409353
Ig strand G 1545..1555 CDD:409353
I-set 1602..1690 CDD:400151
Ig strand A 1602..1604 CDD:409353
Ig strand A' 1606..1612 CDD:409353
Ig strand B 1619..1626 CDD:409353
Ig strand C 1632..1637 CDD:409353
Ig strand C' 1639..1642 CDD:409353
Ig strand D 1649..1652 CDD:409353
Ig strand E 1655..1662 CDD:409353
Ig strand F 1669..1677 CDD:409353
Ig 1838..1929 CDD:416386
Ig strand A 1838..1840 CDD:409353
Ig strand A' 1842..1848 CDD:409353
Ig strand B 1855..1862 CDD:409353
Ig strand C 1868..1873 CDD:409353
Ig strand C' 1875..1878 CDD:409353
Ig strand D 1884..1888 CDD:409353
Ig strand E 1893..1900 CDD:409353
Ig strand F 1907..1915 CDD:409353
Ig strand G 1918..1929 CDD:409353
Ig 1936..2022 CDD:416386
Ig strand A' 1938..1944 CDD:409353
Ig strand B 1952..1958 CDD:409353
Ig strand C 1964..1969 CDD:409353
Ig strand C' 1971..1974 CDD:409353
Ig strand D 1979..1983 CDD:409353
Ig strand E 1988..1995 CDD:409353
Ig strand F 2002..2010 CDD:409353
Ig strand G 2013..2023 CDD:409353
Ig 2028..2106 CDD:416386
Ig strand C 2056..2061 CDD:409353
Ig strand C' 2064..2067 CDD:409353
Ig strand D 2072..2077 CDD:409353
Ig strand E 2080..2085 CDD:409353
Ig strand F 2094..2100 CDD:409353
Ig strand G 2103..2111 CDD:409353
Ig 2117..2188 CDD:416386
Ig strand A' 2122..2127 CDD:409353
Ig strand B 2132..2139 CDD:409353
Ig strand C 2146..2151 CDD:409353
Ig strand C' 2152..2155 CDD:409353
Ig strand D 2161..2167 CDD:409353
Ig strand E 2169..2179 CDD:409353
Ig strand F 2183..2191 CDD:409353
Ig strand G 2193..2202 CDD:409353
Ig 2207..2290 CDD:416386
Ig strand A' 2214..2217 CDD:409353
Ig strand B 2221..2227 CDD:409353
Ig strand C 2235..2240 CDD:409353
Ig strand C' 2243..2246 CDD:409353
Ig strand D 2251..2256 CDD:409353
Ig strand E 2259..2264 CDD:409353
Ig strand F 2273..2279 CDD:409353
Ig strand G 2282..2290 CDD:409353
Ig 2294..2377 CDD:416386
Ig strand B 2309..2315 CDD:409353
Ig strand C 2322..2327 CDD:409353
Ig strand C' 2330..2333 CDD:409353
Ig strand D 2338..2343 CDD:409353
Ig strand E 2346..2351 CDD:409353
Ig strand F 2360..2366 CDD:409353
Ig strand G 2369..2377 CDD:409353
Ig 2382..2464 CDD:416386
Ig strand C 2409..2414 CDD:409353
Ig strand C' 2417..2420 CDD:409353
Ig strand D 2425..2430 CDD:409353
Ig strand E 2433..2438 CDD:409353
Ig strand F 2447..2453 CDD:409353
Ig strand G 2456..2464 CDD:409353
Ig 2468..2552 CDD:416386
Ig strand A' 2471..2477 CDD:409353
Ig strand B 2484..2491 CDD:409353
Ig strand C 2494..2502 CDD:409353
Ig strand C' 2504..2507 CDD:409353
Ig strand D 2512..2516 CDD:409353
Ig strand E 2521..2528 CDD:409353
Ig strand G 2542..2553 CDD:409353
Ig 2556..2639 CDD:416386
Ig strand B 2572..2576 CDD:409353
Ig strand C 2585..2588 CDD:409353
Ig strand E 2609..2613 CDD:409353
Ig strand F 2623..2628 CDD:409353
Ig 2644..2726 CDD:416386
Ig strand A' 2646..2652 CDD:409353
Ig strand B 2659..2666 CDD:409353
Ig strand C 2672..2676 CDD:409353
Ig strand C' 2678..2681 CDD:409353
Ig strand D 2686..2690 CDD:409353
Ig strand E 2695..2702 CDD:409353
Ig strand F 2709..2717 CDD:409353
Ig 2731..2811 CDD:416386
Ig strand A' 2733..2739 CDD:409353
Ig strand B 2746..2755 CDD:409353
Ig strand C 2758..2763 CDD:409353
Ig strand C' 2765..2768 CDD:409353
Ig strand D 2773..2777 CDD:409353
Ig strand E 2782..2789 CDD:409353
Ig strand G 2803..2814 CDD:409353
I-set 2819..2902 CDD:400151
Ig strand A' 2822..2828 CDD:409353
Ig strand B 2835..2842 CDD:409353
Ig strand C 2847..2852 CDD:409353
Ig strand C' 2854..2857 CDD:409353
Ig strand D 2862..2866 CDD:409353
Ig strand E 2871..2878 CDD:409353
Ig strand G 2892..2903 CDD:409353
Ig 2999..3089 CDD:416386
Ig strand A 2999..3001 CDD:409353
Ig strand A' 3003..3009 CDD:409353
Ig strand B 3016..3023 CDD:409353
Ig strand C 3029..3034 CDD:409353
Ig strand D 3044..3048 CDD:409353
Ig strand E 3053..3060 CDD:409353
Ig strand F 3067..3075 CDD:409353
Ig strand G 3078..3089 CDD:409353
Ig strand A 3104..3107 CDD:409353
I-set 3105..3192 CDD:400151
Ig strand A' 3110..3114 CDD:409353
Ig strand B 3122..3130 CDD:409353
Ig strand C 3134..3139 CDD:409353
Ig strand C' 3142..3144 CDD:409353
Ig strand D 3150..3155 CDD:409353
Ig strand E 3158..3163 CDD:409353
Ig strand F 3172..3180 CDD:409353
Ig strand G 3183..3191 CDD:409353
I-set 3288..3376 CDD:400151
Ig strand B 3305..3309 CDD:409353
Ig strand C 3317..3321 CDD:409353
Ig strand E 3342..3346 CDD:409353
Ig strand F 3356..3361 CDD:409353
Ig strand G 3370..3373 CDD:409353
Ig 3460..3550 CDD:416386
Ig strand A 3460..3463 CDD:409353
Ig strand A' 3467..3472 CDD:409353
Ig strand B 3477..3484 CDD:409353
Ig strand C 3491..3496 CDD:409353
Ig strand C' 3497..3500 CDD:409353
Ig strand D 3506..3512 CDD:409353
Ig strand E 3515..3525 CDD:409353
Ig strand F 3529..3537 CDD:409353
Ig strand G 3539..3550 CDD:409353
I-set 3620..3709 CDD:400151
Ig strand A 3620..3623 CDD:409353
Ig strand A' 3626..3631 CDD:409353
Ig strand B 3636..3643 CDD:409353
Ig strand C 3650..3656 CDD:409353
Ig strand C' 3657..3660 CDD:409353
Ig strand D 3666..3672 CDD:409353
Ig strand E 3674..3684 CDD:409353
Ig strand F 3688..3696 CDD:409353
Ig strand G 3698..3709 CDD:409353
I-set 3740..3830 CDD:400151
Ig strand B 3756..3764 CDD:409353
Ig strand C 3769..3775 CDD:409353
Ig strand C' 3778..3780 CDD:409353
Ig strand D 3786..3791 CDD:409353
Ig strand E 3794..3802 CDD:409353
Ig strand F 3810..3817 CDD:409353
Ig strand G 3820..3830 CDD:409353
Ig 4692..4780 CDD:416386
Ig strand C 4721..4724 CDD:409353
Ig strand E 4745..4749 CDD:409353
Ig strand F 4760..4765 CDD:409353
I-set 4785..4874 CDD:400151
Ig strand B 4800..4808 CDD:409353
Ig strand C 4814..4819 CDD:409353
putative Ig strand D 4831..4835 CDD:409353
Ig strand E 4840..4844 CDD:409353
Ig strand F 4854..4859 CDD:409353
Ig strand G 4866..4874 CDD:409353
I-set 4880..4969 CDD:400151
Ig strand A 4880..4882 CDD:409353
Ig strand A' 4884..4890 CDD:409353
Ig strand B 4897..4904 CDD:409353
Ig strand C 4910..4915 CDD:409353
Ig strand C' 4917..4920 CDD:409353
Ig strand D 4925..4929 CDD:409353
Ig strand E 4934..4941 CDD:409353
Ig strand F 4948..4956 CDD:409353
Ig strand G 4959..4969 CDD:409353
I-set 4973..5052 CDD:400151
Ig strand B 4990..4994 CDD:409353
Ig strand C 5003..5007 CDD:409353
Ig strand E 5028..5032 CDD:409353
Ig strand F 5042..5047 CDD:409353
I-set 5066..5156 CDD:400151
Ig strand B 5084..5088 CDD:409353
Ig strand C 5097..5101 CDD:409353
Ig strand E 5122..5126 CDD:409353
Ig strand F 5136..5141 CDD:409353
I-set 5160..5245 CDD:400151
Ig strand A 5160..5163 CDD:409353
Ig strand A' 5166..5171 CDD:409353
Ig strand B 5176..5183 CDD:409353
Ig strand C 5190..5196 CDD:409353
Ig strand C' 5197..5200 CDD:409353
Ig strand D 5206..5212 CDD:409353
Ig strand E 5214..5224 CDD:409353
Ig strand F 5228..5236 CDD:409353
I-set 5253..5342 CDD:400151
Ig strand A 5253..5256 CDD:409353
Ig strand A' 5259..5264 CDD:409353
Ig strand B 5269..5276 CDD:409353
Ig strand C 5283..5289 CDD:409353
Ig strand C' 5290..5293 CDD:409353
Ig strand D 5299..5305 CDD:409353
Ig strand E 5307..5317 CDD:409353
Ig strand F 5321..5329 CDD:409353
Ig strand G 5331..5342 CDD:409353
I-set 5347..5435 CDD:400151
Ig strand B 5363..5367 CDD:409353
Ig strand C 5376..5380 CDD:409353
Ig strand E 5401..5405 CDD:409353
Ig strand F 5415..5420 CDD:409353
Ig strand G 5429..5432 CDD:409353
I-set 5442..5530 CDD:400151
Ig strand A 5442..5445 CDD:409353
Ig strand A' 5448..5453 CDD:409353
Ig strand B 5458..5465 CDD:409353
Ig strand C 5472..5478 CDD:409353
Ig strand C' 5479..5482 CDD:409353
Ig strand D 5487..5493 CDD:409353
Ig strand E 5495..5505 CDD:409353
Ig strand F 5509..5517 CDD:409353
Ig strand G 5519..5530 CDD:409353
Ig strand A 5533..5536 CDD:409353
I-set 5534..5623 CDD:400151
Ig strand A' 5539..5543 CDD:409353
Ig strand B 5551..5559 CDD:409353
Ig strand C 5564..5569 CDD:409353
Ig strand C' 5572..5574 CDD:409353
Ig strand D 5580..5585 CDD:409353
Ig strand E 5588..5593 CDD:409353
Ig strand F 5602..5610 CDD:409353
Ig strand G 5613..5623 CDD:409353
I-set 5642..5717 CDD:400151
Ig strand B 5645..5649 CDD:409353
Ig strand C 5658..5662 CDD:409353
Ig strand E 5683..5687 CDD:409353
Ig strand F 5697..5702 CDD:409353
Ig 5721..5809 CDD:416386
Ig strand B 5738..5742 CDD:409353
Ig strand C 5751..5755 CDD:409353
Ig strand E 5776..5780 CDD:409353
Ig strand F 5790..5795 CDD:409353
Ig strand G 5804..5807 CDD:409353
I-set 5814..5903 CDD:400151
Ig strand B 5831..5835 CDD:409353
Ig strand C 5844..5848 CDD:409353
Ig strand E 5869..5873 CDD:409353
Ig strand F 5883..5888 CDD:409353
Ig strand G 5897..5900 CDD:409353
I-set 5915..5996 CDD:400151
Ig strand B 5924..5928 CDD:409353
Ig strand C 5937..5941 CDD:409353
Ig strand E 5962..5966 CDD:409353
Ig strand F 5976..5981 CDD:409353
I-set 6003..6092 CDD:400151
Ig strand B 6020..6024 CDD:409353
Ig strand C 6033..6037 CDD:409353
Ig strand E 6058..6062 CDD:409353
Ig strand F 6072..6077 CDD:409353
Ig strand A 6095..6098 CDD:409353
Ig 6096..6185 CDD:416386
Ig strand A' 6101..6105 CDD:409353
Ig strand B 6113..6121 CDD:409353
Ig strand C 6126..6131 CDD:409353
Ig strand C' 6134..6136 CDD:409353
Ig strand D 6142..6147 CDD:409353
Ig strand E 6150..6155 CDD:409353
Ig strand F 6164..6172 CDD:409353
Ig strand G 6175..6185 CDD:409353
I-set 6189..6277 CDD:400151
Ig strand A 6189..6192 CDD:409353
Ig strand A' 6195..6201 CDD:409353
Ig strand B 6206..6213 CDD:409353
Ig strand C 6220..6226 CDD:409353
Ig strand C' 6227..6230 CDD:409353
Ig strand E 6242..6252 CDD:409353
Ig strand F 6256..6264 CDD:409353
Ig strand G 6266..6277 CDD:409353
I-set 6281..6369 CDD:400151
Ig strand B 6298..6302 CDD:409353
Ig strand C 6311..6315 CDD:409353
Ig strand E 6336..6340 CDD:409353
Ig strand F 6350..6355 CDD:409353
I-set 6374..6462 CDD:400151
Ig strand B 6391..6395 CDD:409353
Ig strand C 6404..6408 CDD:409353
Ig strand E 6429..6433 CDD:409353
Ig strand F 6443..6448 CDD:409353
I-set 6468..6556 CDD:400151
Ig strand A' 6471..6477 CDD:409353
Ig strand B 6484..6491 CDD:409353
Ig strand C 6497..6502 CDD:409353
Ig strand C' 6504..6507 CDD:409353
Ig strand D 6512..6516 CDD:409353
Ig strand E 6521..6528 CDD:409353
Ig strand F 6535..6543 CDD:409353
Ig strand G 6546..6556 CDD:409353
Ig strand A 6562..6565 CDD:409353
I-set 6563..6652 CDD:400151
Ig strand A' 6568..6572 CDD:409353
Ig strand B 6580..6588 CDD:409353
Ig strand C 6593..6598 CDD:409353
Ig strand C' 6601..6603 CDD:409353
Ig strand D 6609..6614 CDD:409353
Ig strand E 6617..6622 CDD:409353
Ig strand F 6631..6639 CDD:409353
Ig strand G 6642..6652 CDD:409353
Ig strand A 6655..6658 CDD:409353
I-set 6656..6745 CDD:400151
Ig strand A' 6661..6665 CDD:409353
Ig strand B 6673..6681 CDD:409353
Ig strand C 6686..6691 CDD:409353
Ig strand C' 6694..6696 CDD:409353
Ig strand D 6702..6707 CDD:409353
Ig strand E 6710..6715 CDD:409353
Ig strand F 6724..6732 CDD:409353
Ig strand G 6735..6745 CDD:409353
I-set 6749..6836 CDD:400151
Ig strand C 6780..6784 CDD:409353
Ig strand E 6805..6809 CDD:409353
Ig strand F 6819..6824 CDD:409353
Ig strand G 6832..6835 CDD:409353
I-set 6843..6931 CDD:400151
Ig strand B 6860..6864 CDD:409353
Ig strand C 6873..6877 CDD:409353
Ig strand E 6898..6902 CDD:409353
Ig strand F 6912..6917 CDD:409353
Ig strand A 6935..6939 CDD:409353
I-set 6936..7026 CDD:400151
Ig strand A' 6944..6948 CDD:409353
Ig strand B 6952..6961 CDD:409353
Ig strand C 6965..6971 CDD:409353
Ig strand C' 6974..6977 CDD:409353
Ig strand D 6983..6988 CDD:409353
Ig strand E 6992..6997 CDD:409353
Ig strand F 7005..7013 CDD:409353
Ig strand G 7016..7032 CDD:409353
Ig strand A 7029..7036 CDD:409353
I-set 7032..7119 CDD:400151
Ig strand A' 7037..7042 CDD:409353
Ig strand B 7047..7055 CDD:409353
Ig strand C 7059..7065 CDD:409353
Ig strand C' 7067..7069 CDD:409353
Ig strand D 7075..7081 CDD:409353
Ig strand E 7084..7090 CDD:409353
Ig strand F 7099..7106 CDD:409353
Ig strand A 7125..7128 CDD:409353
I-set 7126..7215 CDD:400151
Ig strand A' 7134..7137 CDD:409353
Ig strand B 7143..7150 CDD:409353
Ig strand C 7156..7161 CDD:409353
Ig strand C' 7164..7166 CDD:409353
Ig strand D 7173..7177 CDD:409353
Ig strand E 7179..7185 CDD:409353
Ig strand F 7194..7202 CDD:409353
Ig strand G 7205..7215 CDD:409353
Ig strand A 7218..7221 CDD:409353
I-set 7219..7308 CDD:400151
Ig strand A' 7224..7228 CDD:409353
Ig strand B 7236..7244 CDD:409353
Ig strand C 7249..7254 CDD:409353
Ig strand C' 7257..7259 CDD:409353
Ig strand D 7265..7270 CDD:409353
Ig strand F 7287..7295 CDD:409353
Ig strand G 7298..7308 CDD:409353
I-set 7314..7401 CDD:400151
Ig strand C 7342..7346 CDD:409353
Ig strand E 7367..7371 CDD:409353
Ig strand F 7381..7386 CDD:409353
I-set 7405..7494 CDD:400151
Ig strand B 7423..7426 CDD:409353
Ig strand C 7435..7439 CDD:409353
Ig strand E 7460..7464 CDD:409353
Ig strand F 7474..7479 CDD:409353
Ig strand G 7488..7491 CDD:409353
Ig strand A 7500..7503 CDD:409353
I-set 7501..7590 CDD:400151
Ig strand A' 7506..7510 CDD:409353
Ig strand B 7518..7526 CDD:409353
Ig strand C 7531..7536 CDD:409353
Ig strand C' 7539..7541 CDD:409353
Ig strand D 7547..7552 CDD:409353
Ig strand E 7555..7560 CDD:409353
Ig strand F 7569..7577 CDD:409353
Ig strand G 7580..7590 CDD:409353
I-set 7597..7686 CDD:400151
Ig strand C 7627..7631 CDD:409353
Ig strand E 7652..7656 CDD:409353
Ig strand F 7666..7671 CDD:409353
I-set 7690..7780 CDD:400151
Ig strand B 7709..7712 CDD:409353
Ig strand C 7721..7725 CDD:409353
Ig strand E 7746..7750 CDD:409353
Ig strand F 7760..7765 CDD:409353
I-set 7784..7867 CDD:400151
Ig strand B 7801..7805 CDD:409353
Ig strand C 7814..7818 CDD:409353
Ig strand E 7839..7843 CDD:409353
Ig strand F 7853..7858 CDD:409353
Ig strand A 7876..7880 CDD:409353
I-set 7877..7967 CDD:400151
Ig strand A' 7885..7889 CDD:409353
Ig strand B 7893..7902 CDD:409353
Ig strand C 7906..7912 CDD:409353
Ig strand C' 7915..7917 CDD:409353
Ig strand D 7924..7929 CDD:409353
Ig strand E 7933..7938 CDD:409353
Ig strand F 7946..7954 CDD:409353
Ig strand G 7957..7973 CDD:409353
I-set 7973..8060 CDD:400151
Ig strand A' 7975..7981 CDD:409353
Ig strand B 7988..7995 CDD:409353
Ig strand C 8001..8006 CDD:409353
Ig strand C' 8008..8011 CDD:409353
Ig strand D 8016..8020 CDD:409353
Ig strand E 8025..8032 CDD:409353
Ig strand F 8039..8047 CDD:409353
Ig strand G 8050..8060 CDD:409353
I-set 8067..8156 CDD:400151
Ig strand A 8070..8073 CDD:409353
Ig strand A' 8075..8078 CDD:409353
Ig strand B 8082..8091 CDD:409353
Ig strand C 8096..8102 CDD:409353
Ig strand C' 8105..8107 CDD:409353
Ig strand D 8113..8118 CDD:409353
Ig strand E 8120..8128 CDD:409353
Ig strand F 8136..8143 CDD:409353
Ig strand G 8146..8156 CDD:409353
I-set 8160..8249 CDD:400151
Ig strand A 8160..8163 CDD:409353
Ig strand A' 8166..8171 CDD:409353
Ig strand B 8176..8183 CDD:409353
Ig strand C 8190..8196 CDD:409353
Ig strand C' 8197..8200 CDD:409353
Ig strand D 8206..8212 CDD:409353
Ig strand E 8215..8224 CDD:409353
Ig strand F 8228..8236 CDD:409353
Ig strand G 8238..8249 CDD:409353
I-set 8255..8342 CDD:400151
Ig strand B 8270..8274 CDD:409353
Ig strand C 8283..8287 CDD:409353
Ig strand E 8308..8312 CDD:409353
Ig strand F 8322..8327 CDD:409353
I-set 8346..8435 CDD:400151
Ig strand A 8346..8349 CDD:409353
Ig strand A' 8352..8357 CDD:409353
Ig strand B 8362..8369 CDD:409353
Ig strand C 8376..8382 CDD:409353
Ig strand C' 8383..8386 CDD:409353
Ig strand D 8392..8398 CDD:409353
Ig strand E 8400..8410 CDD:409353
Ig strand F 8414..8422 CDD:409353
Ig strand G 8424..8435 CDD:409353
I-set 8442..8530 CDD:400151
Ig strand B 8459..8463 CDD:409353
Ig strand C 8472..8476 CDD:409353
Ig strand E 8497..8501 CDD:409353
Ig strand F 8511..8516 CDD:409353
I-set 8538..8627 CDD:400151
Ig strand A 8538..8541 CDD:409353
Ig strand A' 8544..8549 CDD:409353
Ig strand B 8554..8561 CDD:409353
Ig strand C 8568..8574 CDD:409353
Ig strand C' 8575..8578 CDD:409353
Ig strand D 8584..8590 CDD:409353
Ig strand E 8593..8602 CDD:409353
Ig strand F 8606..8614 CDD:409353
Ig strand G 8616..8627 CDD:409353
I-set 8631..8721 CDD:400151
Ig strand A 8631..8634 CDD:409353
Ig strand A' 8637..8642 CDD:409353
Ig strand B 8648..8655 CDD:409353
Ig strand C 8662..8668 CDD:409353
Ig strand C' 8669..8672 CDD:409353
Ig strand D 8678..8685 CDD:409353
Ig strand E 8688..8696 CDD:409353
Ig strand F 8700..8708 CDD:409353
Ig strand G 8710..8721 CDD:409353
Ig strand A 8724..8727 CDD:409353
I-set 8725..8813 CDD:400151
Ig strand A' 8730..8734 CDD:409353
Ig strand B 8742..8750 CDD:409353
Ig strand C 8755..8760 CDD:409353
Ig strand C' 8763..8765 CDD:409353
Ig strand D 8771..8776 CDD:409353
Ig strand E 8779..8784 CDD:409353
Ig strand F 8793..8801 CDD:409353
Ig strand A 8817..8821 CDD:409353
I-set 8818..8908 CDD:400151
Ig strand A' 8826..8830 CDD:409353
Ig strand B 8834..8843 CDD:409353
Ig strand C 8847..8853 CDD:409353
Ig strand C' 8856..8859 CDD:409353
Ig strand D 8865..8870 CDD:409353
Ig strand E 8874..8879 CDD:409353
Ig strand F 8887..8895 CDD:409353
Ig strand G 8898..8914 CDD:409353
I-set 8913..9001 CDD:400151
Ig strand A' 8916..8922 CDD:409353
Ig strand B 8929..8936 CDD:409353
Ig strand C 8942..8947 CDD:409353
Ig strand D 8957..8961 CDD:409353
Ig strand E 8966..8973 CDD:409353
Ig strand F 8980..8988 CDD:409353
Ig strand G 8991..9001 CDD:409353
I-set 9008..9097 CDD:400151
Ig strand A 9008..9011 CDD:409353
Ig strand A' 9016..9019 CDD:409353
Ig strand B 9025..9032 CDD:409353
Ig strand C 9038..9043 CDD:409353
Ig strand C' 9046..9048 CDD:409353
Ig strand D 9055..9059 CDD:409353
Ig strand E 9061..9067 CDD:409353
Ig strand F 9076..9084 CDD:409353
Ig strand G 9087..9097 CDD:409353
Ig strand A 9100..9103 CDD:409353
I-set 9101..9190 CDD:400151
Ig strand A' 9106..9110 CDD:409353
Ig strand B 9118..9126 CDD:409353
Ig strand C 9131..9136 CDD:409353
Ig strand C' 9139..9141 CDD:409353
Ig strand D 9147..9152 CDD:409353
Ig strand E 9155..9160 CDD:409353
Ig strand F 9169..9177 CDD:409353
Ig strand G 9180..9190 CDD:409353
I-set 9196..9283 CDD:400151
Ig strand B 9211..9215 CDD:409353
Ig strand C 9224..9228 CDD:409353
Ig strand E 9249..9253 CDD:409353
Ig strand F 9263..9268 CDD:409353
I-set 9287..9376 CDD:400151
Ig strand A 9287..9289 CDD:409353
Ig strand A' 9291..9297 CDD:409353
Ig strand B 9304..9311 CDD:409353
Ig strand C 9317..9322 CDD:409353
Ig strand C' 9324..9327 CDD:409353
Ig strand E 9341..9348 CDD:409353
Ig strand F 9355..9363 CDD:409353
Ig strand G 9366..9377 CDD:409353
I-set 9383..9471 CDD:400151
Ig strand C 9413..9417 CDD:409353
Ig strand E 9438..9442 CDD:409353
Ig strand F 9452..9457 CDD:409353
I-set 9479..9568 CDD:400151
Ig strand B 9496..9500 CDD:409353
Ig strand C 9509..9513 CDD:409353
Ig strand E 9534..9538 CDD:409353
Ig strand F 9548..9553 CDD:409353
Ig strand G 9561..9564 CDD:409353
Ig strand A 9574..9577 CDD:409353
Ig 9575..9665 CDD:416386
Ig strand A' 9580..9583 CDD:409353
Ig strand B 9593..9601 CDD:409353
Ig strand C 9606..9611 CDD:409353
Ig strand C' 9614..9616 CDD:409353
Ig strand D 9622..9627 CDD:409353
Ig strand E 9630..9635 CDD:409353
Ig strand B 13678..13684 CDD:409353
Ig strand C 13690..13696 CDD:409353
Ig strand D 13708..13713 CDD:409353
Ig strand E 13714..13720 CDD:409353
Ig strand F 13729..13737 CDD:409353
Ig strand G 13740..13750 CDD:409353
FN3 13754..13839 CDD:238020
FN3 13854..13942 CDD:238020
Ig 13966..14046 CDD:416386
Ig strand A 13966..13969 CDD:409353
Ig strand B 13974..13980 CDD:409353
Ig strand C 13986..13992 CDD:409353
Ig strand D 14004..14009 CDD:409353
Ig strand E 14010..14016 CDD:409353
Ig strand F 14025..14033 CDD:409353
Ig strand G 14036..14046 CDD:409353
FN3 14050..14137 CDD:238020
FN3 14149..14241 CDD:238020
FN3 14250..14338 CDD:238020
FN3 14350..14436 CDD:238020
FN3 14450..14539 CDD:238020
FN3 14551..14642 CDD:238020
Ig 14662..14742 CDD:416386
Ig strand A 14662..14665 CDD:409353
Ig strand B 14670..14676 CDD:409353
Ig strand C 14682..14688 CDD:409353
Ig strand D 14700..14704 CDD:409353
Ig strand E 14705..14712 CDD:409353
Ig strand F 14721..14729 CDD:409353
Ig strand G 14732..14742 CDD:409353
FN3 14746..14832 CDD:238020
FN3 14846..14938 CDD:238020
Ig 14959..15068 CDD:416386
Ig strand B 14967..14973 CDD:409353
Ig strand C 14979..14985 CDD:409353
Ig strand D 15025..15030 CDD:409353
Ig strand E 15031..15038 CDD:409353
Ig strand F 15047..15055 CDD:409353
Ig strand G 15058..15068 CDD:409353
FN3 15072..15158 CDD:238020
FN3 15173..15265 CDD:238020
FN3 15279..15365 CDD:238020
Ig 15384..15461 CDD:416386
Ig strand A 15384..15387 CDD:409353
Ig strand B 15392..15398 CDD:409353
Ig strand C 15404..15410 CDD:409353
Ig strand D 15421..15426 CDD:409353
Ig strand E 15427..15433 CDD:409353
Ig strand F 15442..15450 CDD:409353
Ig strand G 15453..15461 CDD:409353
FN3 15467..15556 CDD:238020
FN3 15565..15657 CDD:238020
Ig 15677..15764 CDD:416386
Ig strand A 15677..15681 CDD:409353
Ig strand B 15686..15692 CDD:409353
Ig strand C 15698..15704 CDD:409353
Ig strand D 15716..15725 CDD:409353
Ig strand E 15726..15734 CDD:409353
Ig strand F 15743..15751 CDD:409353
Ig strand G 15754..15764 CDD:409353
FN3 15768..15852 CDD:214495
FN3 15869..15963 CDD:238020
FN3 15975..16063 CDD:238020
Ig 16090..16178 CDD:416386
Ig strand A 16090..16093 CDD:409353
Ig strand B 16098..16104 CDD:409353
Ig strand C 16110..16116 CDD:409353
Ig strand D 16136..16141 CDD:409353
Ig strand E 16142..16148 CDD:409353
Ig strand F 16157..16165 CDD:409353
Ig strand G 16168..16178 CDD:409353
FN3 16182..16271 CDD:238020
FN3 16282..16376 CDD:238020
Ig 16401..16483 CDD:416386
Ig strand B 16404..16410 CDD:409353
Ig strand C 16416..16422 CDD:409353
Ig strand D 16441..16446 CDD:409353
Ig strand E 16447..16453 CDD:409353
Ig strand F 16462..16470 CDD:409353
Ig strand G 16473..16483 CDD:409353
FN3 16487..16579 CDD:238020
FN3 16587..16680 CDD:238020
FN3 16676..16783 CDD:238020
Ig_Titin_like 16803..16882 CDD:409406
Ig strand B 16812..16816 CDD:409406
Ig strand C 16825..16829 CDD:409406
Ig strand E 16848..16852 CDD:409406
Ig strand F 16862..16867 CDD:409406
Ig strand G 16875..16878 CDD:409406
FN3 16886..16974 CDD:238020
FN3 16987..17080 CDD:238020
Ig 17098..17178 CDD:416386
Ig strand A 17098..17101 CDD:409353
Ig strand B 17106..17112 CDD:409353
Ig strand C 17118..17124 CDD:409353
Ig strand D 17136..17141 CDD:409353
Ig strand E 17142..17148 CDD:409353
Ig strand F 17157..17165 CDD:409353
Ig strand G 17168..17178 CDD:409353
FN3 17182..17274 CDD:238020
FN3 17282..17371 CDD:238020
FN3 17383..17471 CDD:238020
Ig 17500..17576 CDD:416386
Ig strand B 17506..17512 CDD:409353
Ig strand C 17518..17524 CDD:409353
Ig strand D 17534..17539 CDD:409353
Ig strand E 17540..17546 CDD:409353
Ig strand F 17555..17563 CDD:409353
Ig strand G 17566..17576 CDD:409353
FN3 17580..17667 CDD:238020
FN3 17680..17769 CDD:238020
Ig 17790..17870 CDD:416386
Ig strand A 17790..17793 CDD:409353
Ig strand B 17798..17804 CDD:409353
Ig strand C 17810..17816 CDD:409353
Ig strand D 17828..17833 CDD:409353
Ig strand E 17834..17840 CDD:409353
Ig strand F 17849..17857 CDD:409353
Ig strand G 17860..17870 CDD:409353
FN3 17874..17966 CDD:238020
FN3 17974..18065 CDD:238020
FN3 18074..18160 CDD:238020
Ig 18188..18268 CDD:416386
Ig strand A 18188..18191 CDD:409353
Ig strand B 18196..18202 CDD:409353
Ig strand C 18208..18214 CDD:409353
Ig strand D 18225..18229 CDD:409353
Ig strand E 18230..18238 CDD:409353
Ig strand F 18247..18255 CDD:409353
Ig strand G 18258..18268 CDD:409353
FN3 18272..18362 CDD:238020
FN3 18371..18462 CDD:238020
Ig 18471..18564 CDD:416386
Ig strand A 18471..18473 CDD:409353
Ig strand A' 18476..18482 CDD:409353
Ig strand B 18489..18497 CDD:409353
Ig strand C 18502..18506 CDD:409353
Ig strand C' 18510..18512 CDD:409353
Ig strand D 18519..18525 CDD:409353
Ig strand E 18528..18533 CDD:409353
Ig strand F 18542..18550 CDD:409353
Ig strand G 18553..18564 CDD:409353
FN3 18567..18658 CDD:238020
FN3 18666..18752 CDD:238020
FN3 18767..18865 CDD:238020
Ig 18886..18965 CDD:416386
Ig strand A 18886..18889 CDD:409353
Ig strand B 18894..18900 CDD:409353
Ig strand C 18906..18912 CDD:409353
Ig strand D 18923..18928 CDD:409353
Ig strand E 18929..18935 CDD:409353
Ig strand F 18944..18952 CDD:409353
Ig strand G 18955..18965 CDD:409353
FN3 18969..19056 CDD:238020
FN3 19069..19158 CDD:238020
Ig 19177..19258 CDD:416386
Ig strand A 19177..19181 CDD:409353
Ig strand B 19186..19192 CDD:409353
Ig strand C 19198..19204 CDD:409353
Ig strand D 19216..19221 CDD:409353
Ig strand E 19222..19228 CDD:409353
Ig strand F 19237..19245 CDD:409353
Ig strand G 19248..19258 CDD:409353
FN3 19262..19354 CDD:238020
FN3 19362..19455 CDD:238020
FN3 19461..19555 CDD:238020
Ig 19575..19655 CDD:416386
Ig strand A 19575..19578 CDD:409353
Ig strand B 19583..19589 CDD:409353
Ig strand C 19595..19601 CDD:409353
Ig strand D 19613..19618 CDD:409353
Ig strand E 19619..19625 CDD:409353
Ig strand F 19634..19642 CDD:409353
Ig strand G 19645..19655 CDD:409353
FN3 19659..19750 CDD:238020
FN3 19758..19847 CDD:238020
FN3 19859..19947 CDD:238020
Ig 19973..20053 CDD:416386
Ig strand A 19973..19976 CDD:409353
Ig strand B 19981..19987 CDD:409353
Ig strand C 19993..19999 CDD:409353
Ig strand D 20011..20016 CDD:409353
Ig strand E 20017..20023 CDD:409353
Ig strand F 20032..20040 CDD:409353
Ig strand G 20043..20053 CDD:409353
FN3 20057..20144 CDD:238020
FN3 20154..20242 CDD:238020
Ig_Titin_like 20261..20343 CDD:409406
Ig strand B 20270..20274 CDD:409406
Ig strand C 20283..20287 CDD:409406
Ig strand E 20309..20313 CDD:409406
Ig strand F 20323..20328 CDD:409406
Ig strand G 20336..20339 CDD:409406
FN3 20347..20439 CDD:238020
FN3 20447..20537 CDD:238020
FN3 20546..20635 CDD:238020
Ig 20659..20740 CDD:416386
Ig strand A 20659..20662 CDD:409353
Ig strand B 20667..20674 CDD:409353
Ig strand C 20680..20686 CDD:409353
Ig strand D 20698..20703 CDD:409353
Ig strand E 20704..20710 CDD:409353
Ig strand F 20719..20727 CDD:409353
Ig strand G 20730..20740 CDD:409353
FN3 20744..20835 CDD:238020
FN3 20850..20932 CDD:238020
FN3 20944..21036 CDD:238020
Ig_Titin_like 21056..21135 CDD:409406
Ig strand B 21065..21069 CDD:409406
Ig strand C 21078..21082 CDD:409406
Ig strand E 21101..21105 CDD:409406
Ig strand F 21115..21120 CDD:409406
Ig strand G 21128..21131 CDD:409406
FN3 21139..21230 CDD:238020
FN3 21236..21327 CDD:238020
Ig_Titin_like 21346..21426 CDD:409406
Ig strand B 21354..21358 CDD:409406
Ig strand C 21367..21371 CDD:409406
Ig strand E 21392..21396 CDD:409406
Ig strand F 21406..21411 CDD:409406
Ig strand G 21419..21422 CDD:409406
FN3 21430..21522 CDD:238020
FN3 21530..21622 CDD:238020
FN3 21629..21722 CDD:238020
Ig 21742..21822 CDD:416386 6/36 (17%)
Ig strand A 21742..21745 CDD:409353
Ig strand B 21750..21756 CDD:409353
Ig strand C 21762..21768 CDD:409353
Ig strand D 21780..21785 CDD:409353 2764/11209 (25%)
Ig strand E 21786..21792 CDD:409353 2/5 (40%)
Ig strand F 21801..21809 CDD:409353 1/7 (14%)
Ig strand G 21812..21822 CDD:409353 1/9 (11%)
FN3 21826..21917 CDD:238020 24/105 (23%)
FN3 21926..22018 CDD:238020 18/111 (16%)
FN3 22027..22114 CDD:238020 23/117 (20%)
Ig_Titin_like 22140..22219 CDD:409406 16/85 (19%)
Ig strand B 22149..22153 CDD:409406 0/3 (0%)
Ig strand C 22162..22166 CDD:409406 0/3 (0%)
Ig strand E 22185..22189 CDD:409406 1/3 (33%)
Ig strand F 22199..22204 CDD:409406 1/4 (25%)
Ig strand G 22212..22215 CDD:409406 1/2 (50%)
FN3 22223..22312 CDD:238020 20/117 (17%)
FN3 22320..22403 CDD:238020 21/104 (20%)
Ig_Titin_like 22427..22508 CDD:409406 18/85 (21%)
Ig strand B 22436..22440 CDD:409406 0/3 (0%)
Ig strand C 22449..22453 CDD:409406 1/3 (33%)
Ig strand E 22474..22478 CDD:409406 1/6 (17%)
Ig strand F 22488..22493 CDD:409406 1/4 (25%)
Ig strand G 22501..22504 CDD:409406 0/2 (0%)
FN3 22512..22604 CDD:238020 28/116 (24%)
FN3 22612..22705 CDD:238020 13/92 (14%)
FN3 22711..22804 CDD:238020 13/92 (14%)
Ig 22823..22904 CDD:416386 19/89 (21%)
Ig strand A 22823..22827 CDD:409353 0/3 (0%)
Ig strand B 22832..22838 CDD:409353 2/5 (40%)
Ig strand C 22844..22850 CDD:409353 1/5 (20%)
Ig strand D 22862..22867 CDD:409353 1/4 (25%)
Ig strand E 22868..22874 CDD:409353 1/6 (17%)
Ig strand F 22883..22891 CDD:409353 0/7 (0%)
Ig strand G 22894..22904 CDD:409353 1/9 (11%)
FN3 22908..22999 CDD:238020 15/95 (16%)
FN3 23008..23097 CDD:238020 16/92 (17%)
FN3 23109..23197 CDD:238020 18/94 (19%)
Ig_Titin_like 23223..23301 CDD:409406 11/80 (14%)
Ig strand B 23231..23235 CDD:409406 1/3 (33%)
Ig strand C 23244..23248 CDD:409406 1/3 (33%)
Ig strand E 23267..23271 CDD:409406 0/3 (0%)
Ig strand F 23281..23286 CDD:409406 0/4 (0%)
Ig strand G 23294..23297 CDD:409406 0/2 (0%)
FN3 23305..23391 CDD:238020 16/91 (18%)
FN3 23402..23485 CDD:238020 19/85 (22%)
Ig_Titin_like 23510..23589 CDD:409406 22/80 (28%)
Ig strand B 23518..23522 CDD:409406 0/3 (0%)
Ig strand C 23531..23535 CDD:409406 0/3 (0%)
Ig strand E 23556..23560 CDD:409406 1/3 (33%)
Ig strand F 23570..23575 CDD:409406 2/4 (50%)
Ig strand G 23583..23586 CDD:409406 1/2 (50%)
FN3 23594..23677 CDD:238020 23/185 (12%)
FN3 23694..23786 CDD:238020 19/121 (16%)
FN3 23793..23886 CDD:238020 12/96 (13%)
Ig 23905..23986 CDD:416386 22/80 (28%)
Ig strand A 23905..23909 CDD:409353 2/3 (67%)
Ig strand B 23914..23920 CDD:409353 2/5 (40%)
Ig strand C 23926..23932 CDD:409353 1/5 (20%)
Ig strand D 23944..23949 CDD:409353 1/4 (25%)
Ig strand E 23950..23956 CDD:409353 1/5 (20%)
Ig strand F 23965..23973 CDD:409353 2/7 (29%)
Ig strand G 23976..23986 CDD:409353 1/9 (11%)
FN3 23990..24081 CDD:238020 35/95 (37%)
FN3 24090..24179 CDD:238020 37/89 (42%)
FN3 24191..24278 CDD:238020 4/86 (5%)
Ig_Titin_like 24305..24383 CDD:409406 25/83 (30%)
Ig strand B 24313..24317 CDD:409406 1/3 (33%)
Ig strand C 24326..24330 CDD:409406 0/3 (0%)
Ig strand E 24349..24353 CDD:409406 0/3 (0%)
Ig strand F 24363..24368 CDD:409406 3/4 (75%)
Ig strand G 24376..24379 CDD:409406 0/2 (0%)
FN3 24387..24478 CDD:238020 29/92 (32%)
FN3 24484..24567 CDD:238020 31/84 (37%)
Ig 24592..>24653 CDD:416386 16/61 (26%)
Ig strand A 24592..24595 CDD:409353 0/2 (0%)
Ig strand B 24600..24606 CDD:409353 1/5 (20%)
Ig strand C 24612..24618 CDD:409353 2/6 (33%)
Ig strand D 24630..24635 CDD:409353 1/4 (25%)
Ig strand E 24636..24642 CDD:409353 1/5 (20%)
FN3 24676..24769 CDD:238020 36/96 (38%)
FN3 24776..24869 CDD:238020 20/92 (22%)
FN3 24875..24968 CDD:238020 21/92 (23%)
Ig 24987..25069 CDD:416386 22/83 (27%)
Ig strand A 24987..24991 CDD:409353 0/3 (0%)
Ig strand B 24996..25002 CDD:409353 0/5 (0%)
Ig strand C 25008..25014 CDD:409353 3/5 (60%)
Ig strand D 25027..25032 CDD:409353 3/4 (75%)
Ig strand E 25033..25039 CDD:409353 1/5 (20%)
Ig strand F 25048..25056 CDD:409353 2/7 (29%)
Ig strand G 25059..25069 CDD:409353 2/9 (22%)
FN3 25073..25164 CDD:238020 35/92 (38%)
FN3 25173..25265 CDD:238020 32/91 (35%)
FN3 25274..25361 CDD:238020 3/87 (3%)
Ig_Titin_like 25387..25466 CDD:409406 25/80 (31%)
Ig strand B 25396..25400 CDD:409406 0/3 (0%)
Ig strand C 25409..25413 CDD:409406 0/3 (0%)
Ig strand E 25432..25436 CDD:409406 2/3 (67%)
Ig strand F 25446..25451 CDD:409406 2/4 (50%)
Ig strand G 25459..25462 CDD:409406 1/2 (50%)
FN3 25470..25557 CDD:238020 30/88 (34%)
FN3 25567..25650 CDD:238020 34/89 (38%)
Ig_Titin_like 25674..25755 CDD:409406 22/81 (27%)
Ig strand B 25683..25687 CDD:409406 0/3 (0%)
Ig strand C 25696..25700 CDD:409406 1/3 (33%)
Ig strand E 25721..25725 CDD:409406 1/3 (33%)
Ig strand F 25735..25740 CDD:409406 1/4 (25%)
Ig strand G 25748..25751 CDD:409406 1/2 (50%)
FN3 25759..25846 CDD:238020 22/87 (25%)
FN3 25858..25942 CDD:238020 14/83 (17%)
FN3 25957..26050 CDD:238020 37/103 (36%)
Ig_Titin_like 26069..26150 CDD:409406 22/80 (28%)
Ig strand B 26078..26082 CDD:409406 2/3 (67%)
Ig strand C 26091..26095 CDD:409406 1/3 (33%)
Ig strand E 26116..26120 CDD:409406 1/3 (33%)
Ig strand F 26130..26135 CDD:409406 1/4 (25%)
Ig strand G 26143..26146 CDD:409406 0/2 (0%)
FN3 26161..26246 CDD:238020 32/85 (38%)
FN3 26254..26341 CDD:238020 20/86 (23%)
FN3 26355..26444 CDD:238020 14/88 (16%)
Ig_Titin_like 26466..26545 CDD:409406 22/87 (25%)
Ig strand B 26475..26479 CDD:409406 0/3 (0%)
Ig strand C 26488..26492 CDD:409406 0/3 (0%)
Ig strand E 26511..26515 CDD:409406 2/3 (67%)
Ig strand F 26525..26530 CDD:409406 4/4 (100%)
Ig strand G 26538..26541 CDD:409406 0/2 (0%)
FN3 26549..26640 CDD:238020 29/91 (32%)
FN3 26646..26729 CDD:238020 39/99 (39%)
Ig_Titin_like 26756..26837 CDD:409406 25/87 (29%)
Ig strand B 26765..26769 CDD:409406 0/3 (0%)
Ig strand C 26778..26782 CDD:409406 2/3 (67%)
Ig strand E 26803..26807 CDD:409406 1/3 (33%)
Ig strand F 26817..26822 CDD:409406 1/4 (25%)
Ig strand G 26830..26833 CDD:409406 0/2 (0%)
FN3 26841..26934 CDD:238020 32/93 (34%)
FN3 26941..27031 CDD:238020 3/89 (3%)
FN3 27040..27133 CDD:238020 40/92 (43%)
Ig_Titin_like 27152..27232 CDD:409406 20/79 (25%)
Ig strand B 27161..27165 CDD:409406 2/3 (67%)
Ig strand C 27174..27178 CDD:409406 1/3 (33%)
Ig strand E 27199..27203 CDD:409406 0/3 (0%)
Ig strand F 27213..27218 CDD:409406 1/4 (25%)
Ig strand G 27226..27229 CDD:409406 1/2 (50%)
FN3 27237..27329 CDD:238020 33/91 (36%)
FN3 27337..27426 CDD:238020 0/88 (0%)
FN3 27438..27529 CDD:238020 36/91 (40%)
Ig_Titin_like 27552..27633 CDD:409406 24/83 (29%)
Ig strand B 27560..27564 CDD:409406 0/3 (0%)
Ig strand C 27573..27577 CDD:409406 0/3 (0%)
Ig strand E 27598..27602 CDD:409406 1/3 (33%)
Ig strand F 27612..27617 CDD:409406 1/4 (25%)
Ig strand G 27626..27629 CDD:409406 1/2 (50%)
FN3 27637..27726 CDD:238020 33/90 (37%)
FN3 27734..27825 CDD:238020 35/95 (37%)
Ig 27844..27923 CDD:416386 15/78 (19%)
Ig strand A 27844..27847 CDD:409353 1/2 (50%)
Ig strand B 27852..27858 CDD:409353 0/5 (0%)
Ig strand C 27864..27870 CDD:409353 2/5 (40%)
Ig strand D 27882..27887 CDD:409353 0/4 (0%)
Ig strand E 27888..27894 CDD:409353 0/5 (0%)
Ig strand F 27903..27911 CDD:409353 4/7 (57%)
Ig strand G 27914..27923 CDD:409353 0/8 (0%)
FN3 27928..28020 CDD:238020 35/93 (38%)
FN3 28038..28120 CDD:238020 4/81 (5%)
FN3 28127..28215 CDD:238020 35/87 (40%)
Ig 28239..28319 CDD:416386 23/86 (27%)
Ig strand A 28239..28242 CDD:409353 1/2 (50%)
Ig strand B 28247..28253 CDD:409353 0/5 (0%)
Ig strand C 28259..28265 CDD:409353 2/5 (40%)
Ig strand D 28277..28282 CDD:409353 1/4 (25%)
Ig strand E 28283..28289 CDD:409353 2/5 (40%)
Ig strand F 28298..28306 CDD:409353 2/7 (29%)
Ig strand G 28309..28319 CDD:409353 1/9 (11%)
FN3 28330..28415 CDD:238020 28/92 (30%)
FN3 28423..28510 CDD:238020 27/86 (31%)
FN3 28525..28619 CDD:238020 17/93 (18%)
Ig_Titin_like 28637..28716 CDD:409406 24/80 (30%)
Ig strand B 28646..28650 CDD:409406 0/3 (0%)
Ig strand C 28659..28663 CDD:409406 2/3 (67%)
Ig strand E 28682..28686 CDD:409406 1/3 (33%)
Ig strand F 28696..28701 CDD:409406 2/4 (50%)
Ig strand G 28709..28712 CDD:409406 0/2 (0%)
FN3 28720..28812 CDD:238020 34/97 (35%)
FN3 28817..28900 CDD:238020 25/87 (29%)
Ig_Titin_like 28927..28998 CDD:409406 27/70 (39%)
Ig strand B 28936..28940 CDD:409406 0/3 (0%)
Ig strand C 28949..28953 CDD:409406 0/3 (0%)
Ig strand E 28974..28978 CDD:409406 1/3 (33%)
Ig strand F 28988..28993 CDD:409406 1/4 (25%)
FN3 29012..29104 CDD:238020 35/91 (38%)
FN3 29112..29202 CDD:238020 30/89 (34%)
FN3 29211..29307 CDD:238020 41/96 (43%)
Ig_Titin_like 29327..29407 CDD:409406 27/79 (34%)
Ig strand B 29335..29339 CDD:409406 0/3 (0%)
Ig strand C 29348..29352 CDD:409406 1/3 (33%)
Ig strand E 29373..29377 CDD:409406 1/3 (33%)
Ig strand F 29387..29392 CDD:409406 2/4 (50%)
Ig strand G 29400..29403 CDD:409406 2/2 (100%)
FN3 29411..29503 CDD:238020 32/92 (35%)
FN3 29511..29604 CDD:238020 41/96 (43%)
FN3 29613..29706 CDD:238020 6/92 (7%)
Ig_Titin_like 29727..29805 CDD:409406 10/77 (13%)
Ig strand B 29735..29739 CDD:409406 1/3 (33%)
Ig strand C 29748..29752 CDD:409406 0/3 (0%)
Ig strand E 29771..29775 CDD:409406 0/3 (0%)
Ig strand F 29785..29790 CDD:409406 0/4 (0%)
Ig strand G 29798..29801 CDD:409406 0/2 (0%)
FN3 29809..29900 CDD:238020 9/90 (10%)
FN3 29906..29999 CDD:238020 0/92 (0%)
Ig 30018..30099 CDD:416386 12/80 (15%)
Ig strand A 30018..30022 CDD:409353 0/3 (0%)
Ig strand B 30027..30033 CDD:409353 0/5 (0%)
Ig strand C 30039..30045 CDD:409353 0/5 (0%)
Ig strand D 30057..30062 CDD:409353 0/4 (0%)
Ig strand E 30063..30069 CDD:409353 3/5 (60%)
Ig strand F 30078..30086 CDD:409353 3/7 (43%)
Ig strand G 30089..30099 CDD:409353 2/9 (22%)
FN3 30103..30194 CDD:238020 5/90 (6%)
FN3 30203..30292 CDD:238020 13/88 (15%)
FN3 30304..30391 CDD:238020 0/86 (0%)
Ig_Titin_like 30417..30495 CDD:409406 0/77 (0%)
Ig strand B 30425..30429 CDD:409406 0/3 (0%)
Ig strand C 30438..30442 CDD:409406 0/3 (0%)
Ig strand E 30461..30465 CDD:409406 0/3 (0%)
Ig strand F 30475..30480 CDD:409406 0/4 (0%)
Ig strand G 30488..30491 CDD:409406 0/2 (0%)
FN3 30499..30589 CDD:238020 21/89 (24%)
FN3 30600..30693 CDD:238020 35/93 (38%)
FN3 30702..30787 CDD:238020 37/84 (44%)
I-set 30808..30891 CDD:400151 30/87 (34%)
Ig strand B 30821..30825 CDD:409353 1/3 (33%)
Ig strand C 30834..30838 CDD:409353 0/3 (0%)
Ig strand E 30859..30863 CDD:409353 1/3 (33%)
Ig strand F 30873..30878 CDD:409353 3/4 (75%)
Ig 30909..30988 CDD:416386 17/93 (18%)
Ig strand A 30909..30912 CDD:409353 0/2 (0%)
Ig strand B 30917..30923 CDD:409353 0/5 (0%)
Ig strand C 30929..30935 CDD:409353 0/5 (0%)
Ig strand D 30947..30952 CDD:409353 1/4 (25%)
Ig strand E 30953..30959 CDD:409353 1/5 (20%)
Ig strand F 30969..30977 CDD:409353 2/7 (29%)
Ig strand G 30980..30988 CDD:409353 1/7 (14%)
FN3 30994..31088 CDD:238020 35/93 (38%)
FN3 31096..31189 CDD:238020 33/92 (36%)
I-set 31199..31290 CDD:400151 29/90 (32%)
Ig strand A 31199..31201 CDD:409353 1/1 (100%)
Ig strand A' 31203..31209 CDD:409353 2/5 (40%)
Ig strand B 31216..31223 CDD:409353 3/6 (50%)
Ig strand C 31229..31234 CDD:409353 1/4 (25%)
Ig strand C' 31236..31239 CDD:409353 0/2 (0%)
Ig strand D 31247..31250 CDD:409353 0/2 (0%)
Ig strand E 31255..31262 CDD:409353 2/6 (33%)
Ig strand F 31269..31277 CDD:409353 3/7 (43%)
Ig strand G 31280..31291 CDD:409353 4/10 (40%)
Ig 31308..31389 CDD:416386 27/80 (34%)
Ig strand A 31308..31311 CDD:409353 0/2 (0%)
Ig strand B 31316..31322 CDD:409353 4/5 (80%)
Ig strand C 31328..31334 CDD:409353 3/5 (60%)
Ig strand D 31346..31351 CDD:409353 2/4 (50%)
Ig strand E 31352..31358 CDD:409353 1/5 (20%)
Ig strand F 31368..31376 CDD:409353 3/7 (43%)
Ig strand G 31379..31389 CDD:409353 2/9 (22%)
FN3 31393..31484 CDD:238020 33/90 (37%)
STKc_Titin 31520..31796 CDD:271006 108/276 (39%)
IgI_Titin_M1-like 31839..31928 CDD:409521 21/88 (24%)
Ig strand B 31855..31859 CDD:409521 2/3 (67%)
Ig strand C 31869..31873 CDD:409521 1/3 (33%)
Ig strand E 31894..31898 CDD:409521 0/3 (0%)
Ig strand F 31908..31913 CDD:409521 1/4 (25%)
Ig strand G 31921..31924 CDD:409521 0/2 (0%)
I-set 31960..32052 CDD:400151 28/183 (15%)
Ig strand A 31960..31962 CDD:409353 1/1 (100%)
Ig strand A' 31964..31970 CDD:409353 1/5 (20%)
Ig strand B 31977..31984 CDD:409353 0/6 (0%)
Ig strand C 31990..31995 CDD:409353 2/4 (50%)
Ig strand C' 31997..32000 CDD:409353 1/2 (50%)
Ig strand D 32008..32012 CDD:409353 1/3 (33%)
Ig strand E 32017..32024 CDD:409353 1/34 (3%)
Ig strand F 32031..32039 CDD:409353 1/49 (2%)
Ig strand G 32042..32052 CDD:409353 3/20 (15%)
I-set 32065..32155 CDD:400151 25/89 (28%)
Ig strand A 32065..32068 CDD:409353 1/2 (50%)
Ig strand A' 32071..32076 CDD:409353 1/4 (25%)
Ig strand B 32081..32088 CDD:409353 0/6 (0%)
Ig strand C 32095..32101 CDD:409353 1/5 (20%)
Ig strand C' 32102..32105 CDD:409353 1/2 (50%)
Ig strand D 32111..32117 CDD:409353 0/5 (0%)
Ig strand E 32120..32130 CDD:409353 2/9 (22%)
Ig strand F 32134..32142 CDD:409353 3/7 (43%)
Ig strand G 32144..32155 CDD:409353 2/10 (20%)
Ig 32641..32728 CDD:416386
Ig strand A 32641..32643 CDD:409353
Ig strand A' 32645..32651 CDD:409353
Ig strand B 32658..32665 CDD:409353
Ig strand C 32671..32676 CDD:409353
Ig strand C' 32678..32681 CDD:409353
Ig strand D 32686..32690 CDD:409353
Ig strand E 32695..32702 CDD:409353
Ig strand F 32709..32717 CDD:409353
Ig 32827..32916 CDD:416386
Ig strand A 32827..32834 CDD:409353
Ig strand A' 32835..32840 CDD:409353
Ig strand B 32845..32853 CDD:409353
Ig strand C 32857..32863 CDD:409353
Ig strand C' 32865..32867 CDD:409353
Ig strand D 32873..32879 CDD:409353
Ig strand E 32882..32888 CDD:409353
Ig strand F 32897..32904 CDD:409353
Ig strand G 32907..32916 CDD:409353
Ig 32982..33062 CDD:416386
Ig strand B 32997..33001 CDD:409353
Ig strand C 33012..33016 CDD:409353
Ig strand E 33038..33042 CDD:409353
Ig strand F 33052..33057 CDD:409353
Ig 33132..33212 CDD:416386
Ig strand B 33142..33146 CDD:409353
Ig strand C 33153..33157 CDD:409353
Ig strand E 33178..33182 CDD:409353
Ig strand F 33192..33197 CDD:409353
I-set 33220..33309 CDD:400151
Ig strand A 33220..33223 CDD:409353
Ig strand A' 33226..33231 CDD:409353
Ig strand B 33236..33243 CDD:409353
Ig strand C 33250..33256 CDD:409353
Ig strand C' 33257..33260 CDD:409353
Ig strand D 33265..33271 CDD:409353
Ig strand E 33274..33284 CDD:409353
Ig strand F 33288..33296 CDD:409353
Ig strand G 33298..33309 CDD:409353
I-set 33399..33491 CDD:400151
Ig strand B 33416..33422 CDD:409353
Ig strand C 33428..33434 CDD:409353
Ig strand D 33449..33454 CDD:409353
Ig strand E 33455..33461 CDD:409353
Ig strand F 33470..33478 CDD:409353
Ig strand G 33481..33491 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I9399
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004229
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.