DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bt and Ttn

DIOPT Version :10

Sequence 1:NP_001162825.1 Gene:bt / 43814 FlyBaseID:FBgn0005666 Length:8933 Species:Drosophila melanogaster
Sequence 2:NP_001372637.1 Gene:Ttn / 22138 MGIID:98864 Length:35463 Species:Mus musculus


Alignment Length:11790 Identity:2869/11790 - (24%)
Similarity:4415/11790 - (37%) Gaps:3409/11790 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IEW--------FRSDNKVVE--DVRT----KFKIQPVGENKYTVVLELDDVVETDAGLYKVKAKN 90
            ::|        |:..:.|||  |:..    |.....:.||::||    ..:.|..|..::|.|||
Mouse 23362 LKWAKPEYTGGFKITSYVVEKRDLPNGRWLKANFSNILENEFTV----SGLTEDAAYEFRVIAKN 23422

  Fly    91 KSGEVSASINLNFTPADEPKEK------------QID-GFAPTFAKKPAIRQEEDGKRLLFECRV 142
            .:|.:|        |..||.:.            .:| .|..|...|.       |:....|..|
Mouse 23423 AAGAIS--------PPSEPSDAIT
CRDDLEAPRIMVDVRFKDTITLKA-------GEAFKLEADV 23472

  Fly   143 NADPIPAIIWFHNGAAVKESERHKITVDKDVHSYFATLEILN--VTVEDAGKYKVNAKNELGESN 205
            :..|.|.:.|..:|..::.:.:.:|.:     :.|:| .::|  .:..|:|.|.:.|.|..|.:.
Mouse 23473 SGRPPPTMEWTKDGKELEGTGKLEIKI-----ADFST-HLINKDSSRTDSGAYILTATNPGGFAK 23531

  Fly   206 ATISLNFDSDEAPVPESAEGIKPTFTERPVIR---QSEDGGNVTFECRCVGDPTPTVTWSHGETE 267
            ...::.......| ||....:....:|:.|:.   ..:|||............|..:.|::..||
Mouse 23532 HIFNVKV
LDRPGP-PEGPLAVSDVTSEKCVLSWLPPLDDGGAKIDHYIVQKRETSRLAWTNVATE 23595

  Fly   268 LNESNRYKMSLTMDQKLYHIACLEISSVVSSDQGEYRAQAKNKHGSGVATINLNFESGSKKIPDG 332
            :                 .:..|:::.::..::..:|..|.||:|.|..   |..|......|.|
Mouse 23596 V-----------------QVTKLKVTKLLKGNEYIFRVMAVNKYGVGEP---LESEPVLAVDPYG 23640

  Fly   333 KSPRFPKKPTIRQ-EEDLLIMECVLEAHPVPD----IVWYCSEKEICNNQR-TKMTRKAITKDSY 391
             .|..||.|.:.. .:|.::   |...||..|    |:.|..|:.....|| .|..:||:|.   
Mouse 23641 -PPDPPKNPEVTTITKDSMV---VCWGHPDSDGGSEIINYIVERRDKAGQRWVKCNKKALTD--- 23698

  Fly   392 ILTLEIQNPTKEDGGNYRCNAINMYG--------------------------------ESNANIA 424
             |..::...|:.....:|..|.|..|                                .|:.:||
Mouse 23699 -LRFKVSGLTEGHEYEFRIMAENAAGISAPSATSPFYKACDTVFKPGPPGNPRVLDTSRSSISIA 23762

  Fly   425 LN---FQGASDANGF---------------------------APSFIE----------------- 442
            .|   :.|.|:..|:                           ..|.||                 
Mouse 23763 WNKPIYDGGSEITGYMVEIALPEEDEWQVVTPPAGLKATSYTITSLIENQEYKIRIYAMNSEGLG 23827

  Fly   443 KPRIIPNESGT--------------------LITMKCKC--------KAKPEPTVTWYR--GQDL 477
            :|.::|   ||                    ::|::..|        |.:|.|.|.|.|  |:.|
Mouse 23828 EPALVP---GTPKAEERMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWAREHGESL 23889

  Fly   478 VEKSKKIKINTTVIAEDTYELTLEIKDPGATDGGTYRCNVKNEYGESNANLNLNIEAEPEPEGEG 542
                .|..|.:|    .:|.| |.:.:....|.|.|...|:|..|..:|.:|:.:...|.|.   
Mouse 23890 ----DKASIEST----SSYTL-LVVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPP--- 23942

  Fly   543 PTFIEKPRIVSENNGKLVIMECKVKADPKPDVIWFRNGEVIKESNKIKTFIE------------- 594
                               ...|:|...|..|.......::...:|||.:|.             
Mouse 23943 -------------------QNLKIKEVTKTSVTLTWEPPLLDGGSKIKNYIVEKRESTRKAYSTV 23988

  Fly   595 --------------QRGDQYYI------------------------------KLELLD------- 608
                          |.|..||.                              |:.|.|       
Mouse 23989 ATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASERPLPPGKITLTDVTRNSVS 24053

  Fly   609 ------------------PQLEDSGLYKCNIKNTLGELNANLTLNIE------------------ 637
                              .:::..|..:.....|:....|.:|..|:                  
Mouse 24054 LSWEKPEHDGGSRILGYIVEMQSKGSDRWATCATVKVTEATITGLIQGEEYSFRVSAQNEKGISD 24118

  Fly   638 ----IVPVI-KDK--PKIIKIIKKRTVV-------IECTVASKFEPKCTWYKETSTVKESKRHVY 688
                .|||| ||.  |...|::.....|       |:.....:..|..||:|:...:|::.|  .
Mouse 24119 PRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKIDVPFIGRPPPAVTWHKDDIPLKQTTR--V 24181

  Fly   689 QVEQTKEGEFAVKLEINDVEESDKGAYKLVASNEKGEAVSQI-VNLVDIPEEERKPCKPEISRKL 752
            ..|.|:....   |.|.:....|.|.|.:..:|..|||...: |.::|.|.....|.|       
Mouse 24182 NAESTENNSL---LTIKEACREDVGHYTVKLTNSAGEATETLNVIVLDKPGPPTGPVK------- 24236

  Fly   753 ADQKVAESKTFELLVSLSQTDRKCKVEWYKGSTVIR----ETKDITTT----FDGTTARLTFSSA 809
            .|:..|:|      |:||....|     |.|.:.|.    |.:|.:||    ...|.||.|..:.
Mouse 24237 MDEVTADS------VTLSWEPPK-----YDGGSSINNYIVEKRDTSTTAWQIVSATVARTTIKAC 24290

  Fly   810 RTEHTSNY--KVIVTNEVGKDESSCKITVEKVAKKKEEK-------PKEKEKTKNEKEV------ 859
            |.:....|  ::...|..||   |..:..|.|..:...|       |.....:|:..||      
Mouse 24291 RLKTGCEYQFRIAAENRYGK---STYLNSEPVVAQYPFKVPGPPGTPFVTLASKDSMEVQWHEPV 24352

  Fly   860 ------------EQKE------MEEDKNESGQSVAQTEG---------RINIEQI---------- 887
                        |:||      ::.:|....|:..:|.|         |::.|.|          
Mouse 24353 SDGGSKVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGIEYEFRVSAENIVGIGKPSKPS 24417

  Fly   888 ---SEGDP-------------KEELTV-------------------KEEILDKR----------D 907
               :..||             :..:|:                   |:|:.|.|          |
Mouse 24418 ECYAAHDPCDPPGRPEAIIVTRNSVTLQWKKPTYDGGSKITGYIVEKKELPDGRWMKASFTNIID 24482

  Fly   908 TQ-EVK--------ESSVELQDSAG--------------HEVPEPKKATSDSKLDQSNQKNLDKK 949
            || ||.        |..|..:::||              .:..||.:.:.|.|...:......:.
Mouse 24483 TQFEVTGLLEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVEPPRISMDPKYRDTVVVQAGES 24547

  Fly   950 HKTDQSESKTNKNVSLAEPIKSNK--QESEEQQATEQIGLKKVDRKASIVSVKEEISSD----VR 1008
            .|.|..        ...:||.:.:  :..:|..:|.::.:|..|...|: |||:.:..|    :.
Mouse 24548 FKIDAD--------IYGKPIPTTQWVKGDQELSSTARLEIKSTDFATSL-SVKDAVRVDSGNYIL 24603

  Fly  1009 RKSTIKAKEEITVDDK---KASSRRSSLAVEESNTESRRSSIIDKKPLEQ---------VDNKP- 1060
            :...:..::.:|::.|   :.......:|:  |...:.:.::..|.||:.         |:.:. 
Mouse 24604 KAKNVAGEKSVTINVKVLDRPGPPEGPVAI--SGVTAEKCTLAWKPPLQDGGSDITNYIVERRET 24666

  Fly  1061 -------IDAN----------------------------------------KNP--QPLKEEIPR 1076
                   :|||                                        |||  .|...:.|.
Mouse 24667 SRLVWTLVDANVQTLSCKVLKLLEGNEYIFRIMAVNKYGVGEPLESESLIAKNPFVVPDAPKAPE 24731

  Fly  1077 LKPAEKRRTSKVIEEPKPDEG-------LPKLRKASI---------------------------- 1106
            :....|.....|.|.|..|.|       |.|..|..|                            
Mouse 24732 VTAVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLLENHNYEF 24796

  Fly  1107 -------AQVKEEAKPAAPKLKAKAKAKPKYEELPEIPDYERPQLEKYEKSDFTPSDFARDLEIP 1164
                   |.:.|.:.|:|.:.......||.....|::.|..|       .|.|.           
Mouse 24797 RVSAENAAGLSEPSPPSAYQKACDPIYKPGPPNNPKVMDVTR-------SSVFL----------- 24843

  Fly  1165 NKMEKPIIDSGKKEPAVLAQK--------------NGIPKKT----DIIEQYADEPKGLKVGKGK 1211
             ...|||.|.|.:....:.:|              .||.|..    .::|::....:...:.|. 
Mouse 24844 -SWTKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNLEVEKLLEKHEYNFRICAINKA- 24906

  Fly  1212 LPDEGDGRDGAVLKPVIIEPEKEI----LDLGNKKNNQHADKPTVLDIIKQRRRSSIRNLMTKEP 1272
                |.|....|..||::|.:.|.    |||..:|            :|..|...|:|..:   |
Mouse 24907 ----GVGEHADVPGPVMVEEKLEAPDIDLDLELRK------------VINIRAGGSLRLFV---P 24952

  Fly  1273 IQNESFLGVVLKPVIKDTREQA--------------------APQQAIQLTKANATEQF------ 1311
            |:......|....|..|.|:.|                    :.:..:.|..::.|:..      
Mouse 24953 IKGRPTPEVKWGKVDGDIRDAAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRV 25017

  Fly  1312 --SPTKAVKAQVADLKKPETLATLEDNYERPVLE---KYDPFSIDKTK-SEKSTPSIITPDIRGP 1370
              :|:..|..:|.::.|.....|    :|.|:|:   |...:.::|.: :.||..:::|      
Mouse 25018 LDTPSPPVNLKVTEITKDSVSIT----WEPPLLDGGSKIKNYIVEKREATRKSYAAVVT------ 25072

  Fly  1371 EVKLPVQETKEEKQKVPKMQ-------------------PPAPGDPPKIEVIREKRPSLAPEPPS 1416
                   ...:...|:.::|                   |....||.|:..:        |:||.
Mouse 25073 -------NCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPARTADPIKVAEV--------PQPPG 25122

  Fly  1417 R-------RGSLI-----PPADTGRRPSLII---------NDEK---------------KLRPGE 1445
            :       |.|:.     |..|.|   |.||         |.:|               .|..||
Mouse 25123 KITVDDVTRNSVSLSWTKPEHDGG---SKIIQYIVEMQAKNTDKWSECARVKSLDAVITNLTQGE 25184

  Fly  1446 VMDTRLLRPGEVGEGQRRRPSIDVRRPSVQDLEDLINKPSTPLRDVGDGGPPSIVDVQ---ESYS 1507
            ....|::...|.|....|..::.:      ..:||:.:|                ||:   .|||
Mouse 25185 EYLFRVIAVNEKGRSDPRSLAVPI------IAKDLVIEP----------------DVRPAFSSYS 25227

  Fly  1508 VVEDSTAYLTVGVEGSPAPTFKFYKGVSEILEGGRFKFLTDGQTNTITLCMRKCKPNDESKYKIV 1572
            |.......:.|.:.|.|.|:..:.|....:.:..|.. :||....| ||.:::...:|..:|.|.
Mouse 25228 VQVGQDLKIEVPISGRPKPSISWTKDGMPLKQTTRIN-VTDSLDLT-TLSIKETHKDDGGQYGIT 25290

  Fly  1573 VSNIHGEDSAEMQLYVSD-----SSGMDFRAMLKKRRYQKWD-----------------KDEQDP 1615
            |||:.|:.:|.:::...|     ...:.|..:..:.....|:                 :|....
Mouse 25291 VSNVVGQKTAAIEIITLDKPDPPKGPVKFDEISAESITLSWNPPLYTGGCQITNYIVQKRDTTTT 25355

  Fly  1616 NWGDLKETEKPLPALKKVERKV---------------ESFL---SPLIDQFA-KEGKDKKVVFEA 1661
            .| |:.........||..:.|.               :||.   .|::.|:. ||.......|..
Mouse 25356 VW-DVVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESEPVVAQYPYKEPGPPGTPFVT 25419

  Fly  1662 RFSKPNCKPKW---------------LFRKDE-----------VFTGSKFKF--KQENDTYQLII 1698
            ..||.:...:|               |.||:.           :...::||.  .:|...|:..:
Mouse 25420 AISKESMVVQWHEPINNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKALNLEEGIEYEFRV 25484

  Fly  1699 TTPKVEDTGKYTIEIGGVSSTAFLNVEEADP--------------TYTFTKPL---KKKLEGFTQ 1746
            ....:...||     ...:|..::..:..||              |..:|||:   ...:.|:..
Mouse 25485 YAENIVGVGK-----ASKNSECYVARDPCDPPGTPEAIIVKRNEITLQWTKPVYDGGSMITGYIV 25544

  Fly  1747 HETTLECS--VSSSMANVHWFKNNTKLESDDPRY---LISKDINGNLKLIIKDSVLDDAGLYRCQ 1806
            .:..|...  :.:|..||...:......::|.||   :|:|:..|   .|.|.|  |..|.... 
Mouse 25545 EKRDLPEGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAG---AISKPS--DSTGPITA- 25603

  Fly  1807 LDKQPDKTECNLKVTEYPYKFVKVLKSQQCIEKDTV------TLACEID---DAMGEVQWLRNGE 1862
                  |.|..|.......||           :||:      |...|.|   ..:..::|||..:
Mouse 25604 ------KDEVELPRISMDPKF-----------RDTIVVNAGETFRLEADVHGKPLPTIEWLRGDK 25651

  Fly  1863 EIKPDKRIQIVKDGRKRKLVIKDCKVTDAGQF--------------------------------- 1894
            ||:...|.:|.....|..|::||....|.||:                                 
Mouse 25652 EIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVT 25716

  Fly  1895 -----KCT-------------------TNADTTE-------SEIIINYQNRFNKKLKDTEAVERE 1928
                 |||                   ...:|:.       ||::.|       .||.|:.:|..
Mouse 25717 GVTAEKCTLAWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTN-------SLKVTKLLEGN 25774

  Fly  1929 KLILDIELQD--------QTAPCDWKFNGEPIV---PSESIEIKNMG--------------GGKH 1968
            |.|..|...:        ::||...|   .|.|   |.:|:|:.|:.              ||..
Mouse 25775 KYIFRIMAVNKYGVGEPLESAPVLMK---NPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSE 25836

  Fly  1969 QL--IFSSLDMSNEGEITCESGQLS-------------------------------------SKC 1994
            .:  |....|.|....|.|...:::                                     ..|
Mouse 25837 IIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKAC 25901

  Fly  1995 ------------------KLSIRKGESRPNIDCPDKFSG-------------------------- 2015
                              |.||....|:|..|...:..|                          
Mouse 25902 DPVFKPGPPTNAHVVDTTKNSITLAWSKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTR 25966

  Fly  2016 --------------------------------------PISAPVL-------------------L 2023
                                                  .:.||.|                   :
Mouse 25967 FEIAKLIEHQEYKIRVCALNKVGLGEAASVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARI 26031

  Fly  2024 EVPFKVSGTKQTPVEAKLFKDGKPLP--VKDVEVAVTDDKVTFK---------IKKPSRDLSGPY 2077
            .:|||                |:|.|  ....|.....|||..:         |....|:.:|.|
Mouse 26032 HIPFK----------------GRPTPEITWSKEEGEFTDKVQIEKGINFTQLSIDNCDRNDAGKY 26080

  Fly  2078 QIKISNGQGEDTKDVQIICQDVPQPPQDVDITDVYQTSCVVSFNPPSDDGGTPITKYVIERQDLS 2142
            .:|:.|..|..:..|.:...|.|.|||::.:.:|.:.|.::.:.||..|||..:..|||::::.:
Mouse 26081 ILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDSVLLVWEPPIIDGGAKVKNYVIDKREST 26145

  Fly  2143 KKHGWESVAEVLPSEPCLK---KIDDLIPKKQYRFRIRAVNAIGQSDPATFKNTILAKDPWDEPG 2204
            :|    :.|.|  |..|.|   ::::|.....|.||:.|.|..|...|....:.:.|.:|...||
Mouse 26146 RK----AYANV--SSKCNKTSFRVENLTEGAIYYFRVMAENEFGVGVPTETSDAVKASEPPSPPG 26204

  Fly  2205 KPKAVDLTDWDKDHADLKWEAPETDGGDPITAYIVEYKEKFSNDWVSGKEVDGDAR--TATVDGL 2267
            |   |.|||..:..|.|.||.||.|||..|..|:||.:.|.:..|    .|..:::  .|.|.||
Mouse 26205 K---VTLTDVSQTSASLMWEKPEHDGGSRILGYVVEMQPKGTEKW----SVVAESKVCNAVVSGL 26262

  Fly  2268 KEGQQYEFRVRAVNRAGPGEPSDKTKSIIAK-----CRFVKPFIVGEGLKNVTVKKGQTIRFDIK 2327
            ..||:|:|||:|.|..|..:|......:|||     ..|..||      ...:|:.|:.::.:|.
Mouse 26263 SSGQEYQFRVKAYNEKGKSDPRVLGIPVIAKDLTIQPSFKLPF------NTYSVQAGEDLKIEIP 26321

  Fly  2328 YDGEPEPAATWVKGTDNLKFDNQRICLDQLERNSSITIKKSVRKDTGKYKLVLSNSSGTIESEAQ 2392
            ..|.|.|..:|||..:.|| ...|:.:::...::.:.||:|.:.|.|||.:..:||:||......
Mouse 26322 VIGRPRPKISWVKDGEPLK-QTTRVNVEETATSTILHIKESSKDDFGKYSVTATNSAGTATENLS 26385

  Fly  2393 VVVLDRPLPPGGPFEPEEIRASHIKMKWKRPDDDGGCEISGYALERMDEETGRW----------- 2446
            |:||::|.||.||.:.:|:.|..:.:.|:.|...|||:||.|.:|:.|..|..|           
Mouse 26386 VIVLEKPGPPVGPVKFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTNWQMVSATVARTT 26450

  Fly  2447 ------------------------------------IPAGEVGP--------------------- 2454
                                                .|..|.||                     
Mouse 26451 IKISKLKTGTEYQFRIFAENRYGKSTPLDSKPVVVQYPFKEPGPPGTPFVTSISKDQMLVQWHEP 26515

  Fly  2455 -------------------------------NETSFDFKGLTPNKKYKFRVKAINKEGESEPLET 2488
                                           .:|.|...||....:|:|||.|.|..|..:|.:.
Mouse 26516 VNDGGSKVTGYHLEQKEKNSILWVKLNKIPIQDTKFKTTGLDEGLEYEFRVSAENIVGIGKPSKV 26580

  Fly  2489 FDAIVARNPYDPPSPPSQPVIDDYDNKSVLLKWKRPPSDGGRPITHYIVEIKDKFAPSWSEVAKT 2553
            .:..|||:|.|||..|...||   ...||.||||:|..|||..||.||||.||.....|.:.:.|
Mouse 26581 SECYVARDPCDPPGRPEAIVI---TRNSVTLKWKKPVYDGGSKITGYIVEKKDLPDGRWMKASFT 26642

  Fly  2554 DDPNPECNVEGLKEKMVYQFRVRAVNKAGP-SEPSQPTDNHLCKHKNLKP--QIDRSTFKRVTIK 2615
            :....|..|.||.|...|:|||.|.|.|.. ||||:.:.....:.:...|  .:|......:.:.
Mouse 26643 NVVETEFTVTGLVEDQRYEFRVIARNAADNFSEPSESSGAITARDEIDAPNASLDPKYRDVIIVH 26707

  Fly  2616 SGRTHKWSVDVLGEPIPELHWSWRDDIPL-TNGDRIKIENVDYHTDFSITNVLRKDSGFYTLKAE 2679
            :|.|.....|:.|:|||::.|| :|...| ....|::|::....|...:.:.:|.|.|.||||..
Mouse 26708 AGETFVLEADIRGKPIPDIIWS-KDGNELEETAARMEIKSTLQKTTLIVKDCIRTDGGQYTLKLS 26771

  Fly  2680 NRNGIDRETVELVVLGKPSSPKGPLAVSDVTASGCKLQWKKPEDDGGVPIKEYVVEKMDTATGKW 2744
            |..|.....:.:.||.:|..|:|||.|:.|||..|.|.|..|..|||..|..|::||.:|:...|
Mouse 26772 NVGGTKTIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGASISHYIIEKRETSRLSW 26836

  Fly  2745 VRVGRSPGEKEPPSFDVTGLSLGSEYMFRVSAVNEEG-----ESEPLTTLVGVVAKDPFDEPNKP 2804
            .:|.   .|.:..::.||.|..|:||:|||.|||:.|     ||||      |:|.:|:..|..|
Mouse 26837 TQVS---NEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEALESEP------VIACNPYKRPGPP 26892

  Fly  2805 GTPEVTDYDNQSISLKWAAPNNDGGAPIQKYIIEKKNKNKTEWEKALEIPGDQLEATVAGLQEYG 2869
            .|||.:.....|:.|.|..|.:||||.|:.||:||::|....|.|..:.....|...|.||.|..
Mouse 26893 STPEASAITKDSMVLTWTRPVDDGGAEIEGYILEKRDKEGIRWTKCNKKTLTDLRFRVTGLTEGH 26957

  Fly  2870 EYQFRVIAVNKAGLSPPSDASV----------------PQ------------------------- 2893
            .|:|||.|.|.||:..||:.||                |:                         
Mouse 26958 SYEFRVAAENAAGVGEPSEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWNKPIYDGGAPVR 27022

  Fly  2894 --IVKYK------------------------KLK------------------------------- 2901
              :::.|                        |||                               
Mouse 27023 GYVIELKKAAADEWTTCTPPSGLQGKQFTVTKLKENTEYNFRICAFNTEGVGEPATIPGSVVAQE 27087

  Fly  2902 ----PRI--DRSNLKPLLIRAGKPIRYDVNVRGEPAPVITWYQNDKELKPEELPSSSEIKNIPYN 2960
                |.|  |....|.:.:||...:|..|.::|.|.|.:.|     |.....|...::|:.....
Mouse 27088 RMEAPEIELDADLRKVVTLRASATLRLFVTIKGRPEPEVKW-----EKAEGILTERAQIEVTSSY 27147

  Fly  2961 TKISIIETVRKHTGIYKIIAVNEHGQDEATVEVNILAPPSKPRGPLDVKDVTKDSCKLKWKKPED 3025
            |.:.|....|..:|.|.:...|..|...|.|.|.:|..||.|.. |.:::|.|||..|.|:.|..
Mouse 27148 TMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVN-LTIREVKKDSVTLSWEPPLI 27211

  Fly  3026 DGGKPISAYQVEKFDKKQGRWVPLGRTSANDTEFDVKGLQEGHEYQFRVKAINEEGESDPLDSDD 3090
            |||..|:.|.|||.:..:..:..:......:| |.::.||||..|.|||.|.||.|...|.::.:
Mouse 27212 DGGAKITNYIVEKRETTRKAYATITNNCTKNT-FKIENLQEGCSYYFRVLASNEYGIGLPAETAE 27275

  Fly  3091 SIIAKNPYDAASKPGTPNIVDYNEHMVKLKWEAPRSDGGAPISGYIIEKKDKFSPIWDEILSTNT 3155
            .:....|   ...||...:||...:...:|||.|.||||:.|:||::|.:.|.|..|.  ..|..
Mouse 27276 PVKVSEP---PLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWS--ACTQV 27335

  Fly  3156 SVPEATVEGLVEGNIYQFRVRAVNKAGFSDPSDATEPHLAKPRNLKPYINRDKMKPIKVRAGQPV 3220
            ...|.|:.||..|..|.|||.|||:.|.|||.....|.:||...:||.:.. ......|:|...:
Mouse 27336 KTLETTISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIAKDIEIKPSVEL-PFNTFNVKANDQL 27399

  Fly  3221 KFDVDVKGEPAPSLTWFLKETELTSTGQVRLENIDYNTKLTLLDTDRKQSGQYKLRAENINGVDE 3285
            |.|:..||.|..::.|......|..|.:|.:.:....|.|::.:..|:..|.|:|...|..|...
Mouse 27400 KIDIPFKGRPQATVAWKKDGQVLRETTRVNVASSKTVTTLSIKEASREDVGTYELCVSNTAGSIT 27464

  Fly  3286 AVVEVIILDKPSKPEGPIEVSDIHKEGCKLKWRKPKDDGGIPITGYVIEKMDTATGKW-VPAGSV 3349
            ..:.||:||:|. |.|||.:.::..:...:.|..|:.|||..|:.|::||.:|.:..| |.:.:|
Mouse 27465 VPITVIVLDRPG-PPGPIRIDEVSCDNVSISWNPPEYDGGCQISNYIVEKRETTSTTWQVVSQAV 27528

  Fly  3350 DPEKYDIEIKGLDPNHRYQFRVKAVNEEGESEPLETESAITAKNPF------------------- 3395
              .:..|:|..|.....|||||.|.|..|:|...|: ||:.|:.||                   
Mouse 27529 --ARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSES-SAVVAEYPFSPPGPPGTPKVVHATKSTM 27590

  Fly  3396 ----------------------------------------------------------------- 3395
                                                                             
Mouse 27591 VVSWQVPVNDGGSQVIGYHLEYKERSSILWSKANKVLIADTQMKVSGLDEGLMYEYRVYAENIAG 27655

  Fly  3396 --------------DVSAPPGLPELEDWDEHHVKLKWEPPIRDGGSPITNYIIEVMDKDSGEFVK 3446
                          |...|||.||:.:.....|.|||..|..|||:.||.||:|..:...|.::|
Mouse 27656 IGKCSKACEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPRYDGGAKITGYIVERRELPDGRWLK 27720

  Fly  3447 AVETDSPVCKGVVKKLEEGQQYKFRVRAVNKA-GPSDPSEQTNWHVAKPRFLKPHIDRVNLK--- 3507
            ...|:.......|.:|.|.|:|:|||.|.|.| ..|:|||.|.....|.....|.| .:::|   
Mouse 27721 CNFTNVQETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPITVKDDVEAPRI-MMDVKFRD 27784

  Fly  3508 PVIVKTGLSISLDINIRGEPAPKVEWFFNNSSVTSDEHSVKIDNVDYNTKFFVMRAQRSQSGKYI 3572
            .:|||.|..:.::.:|.|.|.|.:.|..:...: .:....:|.:.||.|...|....|..:|:|:
Mouse 27785 VIIVKAGEVLKINADIAGRPLPVISWAKDGVEI-EERAKTEIVSTDYTTTLTVKDCVRRDTGQYV 27848

  Fly  3573 IKATNEVGEDEAELEVTVLGKPGKPKGPLQVNDITKHSCKLKWEKPDDDGGSPIDYYEIEKLDPH 3637
            :...|..|.....:...||.|||.|.|||::|.:|...|.|.|.:|.:|||:.||||.:||.:..
Mouse 27849 LTLKNVAGTRTMAVNCKVLDKPGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETS 27913

  Fly  3638 TGQWLPC-GKSTEPEAKVIGLHEGKAYKFRVRAVNKEGESEDLETEKPIIAKNPYDEPDRPGKPE 3701
            ...|..| .:......||..|.:|..|.|||..|||.|..|.||: ..:.|.:|:..|..|...|
Mouse 27914 RLAWTICEAELRTTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLES-MAVKALDPFTTPSPPTSLE 27977

  Fly  3702 PTNWDKDFVDLAWDPPKNDGGAPIQKYVIQMRDKSGRAW-------------------------- 3740
            .|:..||.:.|.|..|:.|||:.|..|:|:.|:|:...|                          
Mouse 27978 ITSVTKDSMTLCWSRPETDGGSDISGYIIERREKNSLRWMRVNKKPVYDLRVKSTGLREGCEYEY 28042

  Fly  3741 -----------VDSATVP--------------------------------------GDKCNG--- 3753
                       :.|.|.|                                      |....|   
Mouse 28043 RVFAENAAGLSLPSETSPLVRAEDPVFLPSPPSKPKIVDSGKTTITIGWVKPLFDGGAPITGYTV 28107

  Fly  3754 ----------------------TVTGVEEGHEYEFRIVAVNKAGPSDPSDVSKSVIAKPRFLKPH 3796
                                  |::|:..|.||.||:.::||.|.|||||.|...:||.|..:|.
Mouse 28108 EYKKSEETDWKVAIQSFRGTEYTMSGLTTGDEYVFRVRSLNKMGASDPSDSSDPQVAKEREEEPV 28172

  Fly  3797 ID-----RKNLQKKIMRSGQMLHIDALIKAEPPAKVTWTYNKTEIKTSDHIKIENEDYKTTFIMP 3856
            .|     ||.|   |:::|....:....:..|...|:|:...|:::|..:  |::.|.:|...:.
Mouse 28173 FDVDSEMRKTL---IVKAGSSFTMTVPFRGRPIPNVSWSKPDTDLRTRAY--IDSTDSRTLLTIE 28232

  Fly  3857 KVKRADRGIYIVTAKNDSGSDTVEVELEVLCKPSKPKGPLAVSNVTAETLHLKWEKPEDDGGDPI 3921
            ...|.|.|.|.:|.:|...:.::...::||..|..|.. :.|..||.||..|.|:.||:|||.|:
Mouse 28233 NANRNDSGKYTLTIQNVLSAASMTFVVKVLDSPGPPAN-ITVREVTKETAMLSWDVPENDGGAPV 28296

  Fly  3922 EQYLVERMDTETGRWVPV------LTTKTPEADVTGLTEGKEYLFRVKAVNSEGESEPLVTDIPT 3980
            :.|.:|:.:.....||.|      |:.|     ||.|.||..|.|||...|..|      ..:|.
Mouse 28297 KNYHIEKREASKKAWVSVTNNCNRLSYK-----VTNLQEGAIYYFRVSGENEFG------VGVPA 28350

  Fly  3981 KAKNPFDAADTPGKPQ---IVDWSGNHCDLKWRAPEDDGGASITGYIVERKDPNTGKWQKALETS 4042
            :.|......:.|..|:   :...|.:...|.|..||.|||:.|..|:||..:.....|.|.....
Mouse 28351 ETKEGVKITEKPSPPEKLGVTSVSKDSVSLSWLKPEHDGGSRIIHYVVEALEKGQKTWVKCAVVK 28415

  Fly  4043 TPDCKARVNDLIAG----NKYQFRIMAVNKAGKSKPSEPSDQMTAKDRFAPPKIDRTNIKDIT-- 4101
            |      .:.:::|    ::|.||:.|.|:||.|.|.|....:..||:..||:||..|....|  
Mouse 28416 T------THHVVSGLRESHEYFFRVFAENQAGLSDPRELLLPVLIKDQLEPPEIDMKNFPSHTVY 28474

  Fly  4102 IKAGQHIRFDIKVSGEPPATKVWLHNKARLENDDSNYNIDMESYRTKLTVPISKRFHSGKYTLKA 4166
            ::||.:::.||.:||: |..||.|............:|.::.:....:.:..|....:|:|.:.|
Mouse 28475 VRAGSNLKVDIPISGK-PLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTTDAGRYEITA 28538

  Fly  4167 ENESGRDEASFEVIVLDKPGPPEGPLRVTDVHKEGCKLKWNAPLDDGGLPIDHYIIEKMDVESGR 4231
            .|.||..:....:||||:||||.||:.::|:.:|...|||..|..|||..:.:||:.|.:..:..
Mouse 28539 ANSSGTTKTFINIIVLDRPGPPTGPVAISDITEESVTLKWEPPKYDGGSHVTNYIVLKRETSTAV 28603

  Fly  4232 WLP-SGRFKESFAELNNLEPSHEYKFRVLAVNTEGESEPLTGEQSVIAKNPFDEPGKPGTP---- 4291
            |.. |.....:..::..|....||:||:.|.|..|.|:.: ....|:.|.|:..||.|.||    
Mouse 28604 WSEVSATVARTMIKVMKLTTGEEYQFRIKAENRFGISDHI-DSVCVVVKLPYTTPGPPSTPWVSN 28667

  Fly  4292 ---EAV----------------------------------------------------------- 4294
               |::                                                           
Mouse 28668 VTRESITVGWHEPVSNGGSAVTGYHLEMKDRNSILWQKANKMIIRTTHFKVTTISAGLIYEFRVY 28732

  Fly  4295 --------------------------------DWDKDHVDLVWRPPINDGGSPITGYVVEKREKG 4327
                                            |..|:.|:|.|:.|..||||.||||:||:|:..
Mouse 28733 AENAAGIGKPSHPSEPVLAIDACEPPRNVRITDISKNSVNLSWQQPAFDGGSKITGYIVERRDLP 28797

  Fly  4328 TDKWIKGTEITIPCLGEECKATVPTLNENCEYEFRVKAINAAGP-GEPSDASKPIITKPRKLAPK 4391
            ..:|.|.:...:    .|.:.||..|.:|.:|||||.|.||.|. ..||:...||........|.
Mouse 28798 DGRWTKASFTNV----IETQFTVSGLTQNSQYEFRVFARNAVGSVSNPSEVVGPITCIDSYGGPV 28858

  Fly  4392 ID--RKNIRTYNFKSGEPIFLDINISGEPAPDVTWNQNNKSVQTTSFSHIENLPYNTKYINNNPE 4454
            ||  .:......:::|..:.|...|||:|.|.:.|.:::|.:||.:...:||.......:..:..
Mouse 28859 IDLPLEYTEVVKYRAGTSVKLRAGISGKPEPTIEWYKDDKELQTNALVCVENSTDLASILIKDAN 28923

  Fly  4455 RKDTGLYKISAHNFYGQDQVEFQINIITKPGKPEGPLEVSEVHKDGCKLKWKKPKDDGGEPVESY 4519
            |.::|.|::...|..|......::.|:.|||.|.||:|...|..:...|.|:.|.||||..:..|
Mouse 28924 RLNSGSYELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHY 28988

  Fly  4520 LVEKFDPDTGIWLPVGRSDGPEYNVD-------GLVPGHDYKFRVKAVNKEGESEPLETLGSIIA 4577
            :|||.:....:|..|..      |::       .::.|::|.|||:||||.|..||||: ..::|
Mouse 28989 IVEKRETSRVVWSMVAE------NLEECIVTTTKIIKGNEYVFRVRAVNKYGIGEPLES-EPVVA 29046

  Fly  4578 KDPFSVPTKPGVPEPTDWTANKVELAWPEPASDGGSPIQGYIVEVKDKYSPLWEKALETNSPTPT 4642
            |:.|..|..|.:||.|..|.|.:.:.|..|..||||.|.||.:|.:||.|..|.|.|:.......
Mouse 29047 KNAFVTPGPPSIPEVTKITKNSMTVVWDRPTVDGGSEINGYFLERRDKKSLAWLKVLKETIRDTR 29111

  Fly  4643 ATVQGLIEGNEYQFRVVALNKGGL---SEPSD-------------PSKIFTA------------K 4679
            ..|.||.|.::||:||.|:|..|:   |||||             |:||..|            |
Mouse 29112 QKVTGLTENSDYQYRVCAVNAAGVGPFSEPSDFYKAADPIDPPGPPAKIRIADSTKSSITLGWSK 29176

  Fly  4680 PRY-------------------------------------------------------------- 4682
            |.|                                                              
Mouse 29177 PVYDGGSDVTGYVVEMKQGDEEEWTIVSTRGEVRTTEYVVSNLKPGVNYYFQVSAVNCAGQGEPI 29241

  Fly  4683 ------------LAPKIDRR-NLR-NITLSSGTALKLDANITGEPAPKVEWKLSNYHLQSGKNVT 4733
                        ..|:||.. .|| ::...:|..::|.....|.|.|.|.|:....:|.|....:
Mouse 29242 TMTEPAQAKDVLEEPEIDLDVALRTSVIAKAGEDVQLLIPFKGRPPPTVTWRKDEKNLGSDTRYS 29306

  Fly  4734 IETPDYYTKLVIRPTQRSDSGEYLVTATNTSGK-DSVLVNVVITDKPSPPNGPLQISDVHKEGCH 4797
            |:..|..:.|||....|:|:|:|::|..|..|: .|..|:|.:.|.|:... .||:..|......
Mouse 29307 IQNTDSSSLLVIPQVTRNDTGKYILTIENGVGQPKSSTVSVKVLDTPAACQ-KLQVKHVSLGTVT 29370

  Fly  4798 LKWKRPSDDGGTPIEYFQIDKLEPETGCW-IPSCRSTEPQVDVTGLSPGNEYKFRVSAVNAEGES 4861
            |.|..|..|||:||..:.|:|.:.....| :.|.:.:.....||.||....:.|||.|.|..|..
Mouse 29371 LLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKCSGTSFKVTDLSEKTPFFFRVLAENEIGIG 29435

  Fly  4862 QPLVGDESIVARNPFDEPGKPENLKATDWDKDHVDLAWTPPLIDGGSPISCYIIEKQDKYGKWER 4926
            :|....|.:.|.   :.|....:|...|..|..|.|:||.|..||||.|:.|::|::   ||.|:
Mouse 29436 EPCETTEPVKAA---EVPAPIRDLSMKDSTKTSVVLSWTKPDFDGGSIITDYLVERK---GKGEQ 29494

  Fly  4927 ALDVP--ADQCKATIPDLVEGQTYKFRVSAVNAAGTGEPSDSTPPIIAKARNKPPIIDRSSL--V 4987
            |....  :..|:..|..|.|....:|||||.|..|..:|. :..|:..|.....|.:|.|.:  .
Mouse 29495 AWSHAGISKTCEIEIGQLKEQSVLEFRVSARNEKGQSDPV-TIGPLTVKELVITPEVDLSEIPGA 29558

  Fly  4988 EVRIKAGQSFTFDCKVSGEPAPQTKWL-----LKKKEV--YSKDNVKVTNVDYNTKLKVNSATRS 5045
            ::.::.|.:...:....|:|.|...||     ||:.|.  :||...|:|       |.:.::.:.
Mouse 29559 QISVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEYVRFSKTENKIT-------LSIKNSKKE 29616

  Fly  5046 DSGIYTVFAENANGEDSADVKVTVIDKPAPPNGPLKVDEINSESCTLHWNPPDDDGGQPIDNYVV 5110
            ..|.|||..:||...:|..:.:..:..|:.|.||::.|||.::|..:.|:.|:||||..|..|.:
Mouse 29617 HGGKYTVILDNAVCRNSFPITIITLGPPSKPKGPIRFDEIKADSAIMSWDIPEDDGGGEITCYSI 29681

  Fly  5111 EKLDETTGRWIPAGETDGPVTALKVGGLTPGHKYKFRVRAKNRQGTSEPLTTAQAIIAKNPFDVP 5175
            ||.:.:...|.....:... |..||..|....:|:|||||:||.|.|||| .:..|:||:.|.:|
Mouse 29682 EKREASQTNWKMVCSSVAR-TTFKVSNLVKDSEYQFRVRAENRYGVSEPL-ASNIIVAKHQFRIP 29744

  Fly  5176 TKPGTPTIKDFDKEFVDLEWTRPEADGGSPITGYVVEKRDKFSPDWEKCAEISDDITNAHVPDLI 5240
            ..||.|.|.:...:.:.|.|..|..||||.:||:.|||:::.|..|::...............||
Mouse 29745 GPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQRVNTSPISGREYRATGLI 29809

  Fly  5241 EGLKYEFRVRAVNKAGPGSPSDATETHVA------------------------------------ 5269
            |||.|:|||.|.|.||..||||.::..:|                                    
Mouse 29810 EGLDYQFRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIV 29874

  Fly  5270 --------------------------------------------------------------RPK 5272
                                                                          |.:
Mouse 29875 AYSIEKRQGSDRWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGLIMTRDE 29939

  Fly  5273 NTPPKID--RNFMSDIKIKAGNVFEFDVPVTGEPLPSKDWTHEGNMIINTDRVKISNFDDRTKIR 5335
            |.||.::  ..:...:.||:|:.......|.|.|:|...|..:|..|.....::|::....|.:.
Mouse 29940 NVPPTVEFGPEYFDGLVIKSGDSLRIKALVQGRPVPRVTWFKDGVEIERRMNMEITDVLGSTSLF 30004

  Fly  5336 ILDAKRSDTGVYTLTARNINGTDRHNVKVTILDAPSVPEGPLRNGDVSKNSIVLRWRPPKDDGGS 5400
            :.||.|...||||:.|:|::|:.:..|.|.:.|.|....||:|..:::...:.|.|..|.:||.:
Mouse 30005 VRDATRDHRGVYTVEAKNVSGSTKAEVTVKVQDTPGKVVGPIRFTNITGEKMTLWWEAPLNDGCA 30069

  Fly  5401 EITHYVVEKMDNEAMRWVPVGD-CTDTEIRADNLIENHDYSFRVRAVNKQGQSQPLTTSQPITAK 5464
            .:|||::||.:...:.|..:.| |......|..||..::|.||:.||||.|..:|| .|.|:.|:
Mouse 30070 PVTHYIIEKRETSRLAWALIEDNCEALSYTAIKLITGNEYQFRISAVNKFGVGRPL-ESDPVVAQ 30133

  Fly  5465 DPYSHPDKPGQPQATDWGKHFVDLEWSTPKRDGGAPISSYIIEKRPKFG---------------- 5513
            ..|:.||.||.|:.::...:.:.|.|:.|:.|||:.|..||:|:|.|..                
Mouse 30134 IQYTIPDAPGVPEPSNVTGNSITLTWTRPESDGGSEIQHYILERREKKSTRWVKVISKRPISETR 30198

  Fly  5514 -------------------------------------------------------------QWER 5517
                                                                         :|.|
Mouse 30199 FKVTGLVEGNEYEFHVMAENAAGIGPASGISRLIKCREPVNPPSAPSVVKVTDTSKTTVSLEWAR 30263

  Fly  5518 AAV-----VLG---DNCKAH------------------VPELTNGGEYEFRVIAVNRGGPSDPSD 5556
            ...     ::|   :.|||.                  |.:|..|.||:|||.|||..|..|..:
Mouse 30264 PVFDGGMEIIGYIIEMCKADLGDWHKVNTEPCVKTRYTVTDLQAGEEYKFRVSAVNGAGKGDSCE 30328

  Fly  5557 PSSTIICKPRFLAP--FFDKSLLNDITVHAGKRLGWTLPIEASPRPLITWLYNGKEIGSNSRGES 5619
            .:.||....|..||  ..|.:......|.||..:...:..:..|.|...|  :..:...:.|.:.
Mouse 30329 VTGTIKAVDRLSAPELDIDANFKQTHIVRAGVSIRLFIAYQGRPTPTAVW--SKPDSNLSIRADI 30391

  Fly  5620 GLFQNELTFEIVSSLRSDEGRYTLILKNEHGSFDASAHATVLDRPSPPKGPLDITKITRDGCHLT 5684
            ....:..|..:.:..|:|.|:|||.::|..|....:....|||.|.|| ||:....:||....|.
Mouse 30392 HTTDSFSTLTVENCNRNDAGKYTLTVENNSGKKSITFTVKVLDSPGPP-GPITFKDVTRGSATLM 30455

  Fly  5685 WNVPDDDGGSPILHYIIEKMDLSRSTWSDAG-MSTHIVHDVTRLVHRKEYLFRVKAVNAIGESDP 5748
            |:.|..|||:.|.||:|||.:.||.:|.... ..|..:..|:.|.....|.|||.|.|..|..:|
Mouse 30456 WDAPLLDGGARIHHYVIEKREASRRSWQVVSEKCTRQILKVSELTEGVPYYFRVSAENEYGVGEP 30520

  Fly  5749 LEAVNTIIAKNEFDEPDAPGKPIITDWDRDHIDLQWAVPKSDGGAPISEYIIQKKEKGSPYWTNV 5813
            .|....|:|.   ::|..|.:..:.|..:....|.|..|..|||:.|:.|:::.::|||.:|...
Mouse 30521 YEMPEPIVAT---EQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITSYLLEMRQKGSDFWVEA 30582

  Fly  5814 RHVPSNKNTTTIPELTEGQEYEFRVIAVNQAGQSEPSEP-SDMIMAKPRYLPPKIITPLNEVRIK 5877
            .|  :.:.|.|:..|.|..||||||.|.|.||.|||.|. |.:|:.:|:..|...:|.:....|.
Mouse 30583 GH--TKQLTFTVERLVENTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLIT 30645

  Fly  5878 C--GLIFHTDIHFIGEPAPEATWTLNSNPLLSNDRSTITSIGHHSVVHTVNCQRSDSGIYHLLLR 5940
            |  |..|..|:...|.|||:.||.|....|...||.:|.:....:.:...:..|.|||.|.|.|.
Mouse 30646 CKAGSTFTIDVPISGRPAPKVTWKLEEMRLKETDRMSIATTKDRTTLTVKDSMRGDSGRYFLTLE 30710

  Fly  5941 NSSGIDEGSFELVVLDRPGPPEGPMEYEEITANSVTISWKPPKDNGGSEISSYVIEKRDLTHGGG 6005
            |::|:...:..:||:.||||..||:|...::|.|..:||..|||:||:||::|::|||: :....
Mouse 30711 NTAGVKTFTITVVVIGRPGPVTGPIEVSSVSAESCVLSWTEPKDDGGTEITNYIVEKRE-SGTTA 30774

  Fly  6006 WVPAVNYVSAKYNHAVVPRLLEGTMYELRVMAENLQGRSDPLTSDQPVVAKSQYTVPGAPGKPEL 6070
            | ..:| .|.|.....|..|.:...|..||.:||..|.|.||.| .|:||:..:..|.||.:||:
Mouse 30775 W-QLIN-SSVKRTQIKVTHLTKYKEYCFRVSSENRFGVSKPLES-VPIVAEHPFVPPSAPTRPEV 30836

  Fly  6071 TDSDKNHITIKWKQPISNGGSPIIGYDIERRDVNTGRWIKINGQPVPTAEYQDDRVTSNHQYQYR 6135
            .....|.::|:|::|..:|||.|:||.:|:::.||..|:|.|..|.....|:...:....:||:|
Mouse 30837 YYVSANAMSIRWEEPYHDGGSKIVGYWVEKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFR 30901

  Fly  6136 ISAVNAAGNGKTSEPSA------------------------------------------IFNARP 6158
            ..|:||||..|.||.|.                                          |...:|
Mouse 30902 TYALNAAGVSKASEASRPIMAQNPVDPPGRPEVTDVTRSTVSLIWSAPVYDGGSKVVGYIIERKP 30966

  Fly  6159 LRE------------------------------------------------------------KP 6163
            :.|                                                            .|
Mouse 30967 VSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPP 31031

  Fly  6164 RFYFDG-LIGKRIKVRAGEPVNLNIPISGAPTPTIEWKRGDLKLEEGKRISYETNSERTLFRIDD 6227
            :...|. |.|..:.:|||..:.|:..:.|.|.|.|.|.:||.:|:..::||.:...:|....|..
Mouse 31032 KAELDARLQGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKISLQYTGKRATAVIKY 31096

  Fly  6228 SNRRDSGKYTVTAANEFGKDTADIEVIVVDKPSPPEGPLSYTETAPDHISLHWYSPKDDGGSDIT 6292
            .:|.||||||:|..|..|..:..:.|.|:|.|.|. |.|:.:....:..:|.|..|::|||::||
Mouse 31097 CDRSDSGKYTLTVKNASGTKSVSVMVKVLDSPGPC-GKLTVSRVTEEKCTLAWSLPQEDGGAEIT 31160

  Fly  6293 GYIIEFTEFGVDDWKPVPGTCPNTNFTVKNLVEGKKYVFRIRAENIYGASEALEGKPVLAKSPFD 6357
            .||:|..|....:|..|.|.|...::.|..|::..:|.||:||.|.||....:|.:|::|::.|.
Mouse 31161 HYIVERRETSRLNWVIVEGECLTASYVVTRLIKNNEYTFRVRAVNKYGLGVPVESEPIVARNSFT 31225

  Fly  6358 PPGAPSQPTISAYTPNSANLEWHPPDDCGGKPITGYIVERRERGG-EWIKCN-NYPTPNTSYTVS 6420
            .|..|..|...........::|..|:..||..|:.|:|::||:.. .|.:.| :|...:|...|:
Mouse 31226 IPSQPGIPEEVGAGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVT 31290

  Fly  6421 NLRDGARYEFRVLAVNEAGPGHPSKPSDPMTAEHQRYRPDPPEPPKPDRITRNGVTLSWRPPRTD 6485
            :|.:|..|:|||.|||.||...||:.|:.::.....|.|.||..|:....|:..::|:|..|..|
Mouse 31291 SLMEGCDYQFRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKRSISLAWTKPMYD 31355

  Fly  6486 GKSRIKGYYVEMRPKNGKDW--------------------------------------------- 6505
            |.:.|.||.:||:.|:...|                                             
Mouse 31356 GGTDIIGYVLEMQEKDTDQWCRVHTNATIRNNEFTVPDLKMGQKYSFRVAAVNAKGMSDYSETTA 31420

  Fly  6506 ----------------------------------------------------------------- 6505
                                                                             
Mouse 31421 EIEPVERLEIPDLELADDLKKTVIVRAGASLRLMVSVSGRPSPVITWSKKGIDLANRAIIDNTES 31485

  Fly  6506 ----------------------------------------------------------------- 6505
                                                                             
Mouse 31486 YSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVSVKEVSRDSVTITWEIPTI 31550

  Fly  6506 -----------------------------KT---------------------------------- 6507
                                         ||                                  
Mouse 31551 DGGAPVNNYIIEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETSDA 31615

  Fly  6508 --VNDIPI-----------NSTV------------------------------------------ 6517
              |:::|:           .|||                                          
Mouse 31616 VLVSEVPLVPTKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLE 31680

  Fly  6518 YTVPSLKEGEEYSFRVVAENEVGRSDPSKPSQPITIEEQPNKPCMELGKV--RDIVCRAGDDFSI 6580
            :||.||.|||:|.|||.|:||.|.|:|.:...|:|:::....|.::|..:  :.|...||....:
Mouse 31681 HTVISLNEGEQYLFRVRAQNEKGVSEPREIVTPVTVQDLRVLPTIDLSTMPQKTIHVPAGRPIEL 31745

  Fly  6581 HVPYLAFPKPNAFWYSNDNMLDDNNRVHKHLTDDAASVVVKNSKRADSGQYRLQLKNTSGFDTAT 6645
            .:|....|.|.|.|:...:.|.::.||..........:.::.:...|:|:|.|:|||.:|..:.|
Mouse 31746 VIPITGRPPPTASWFFAGSKLRESERVTVETHTKVTKLTIRETTIRDTGEYTLELKNVTGTTSET 31810

  Fly  6646 INVRVLDRPSPPT-RLRADEF-------------------------------------------- 6665
            |.|.:||:|.||| .::.||.                                            
Mouse 31811 IKVIILDKPGPPTGPIKIDEIDATSVTISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTR 31875

  Fly  6666 -------------------------------------------------------SGDSLTLYWN 6675
                                                                   |.|.:||.|.
Mouse 31876 PTFKFTRLTEGNEYVFRVAATNRFGIGSYLQSEVIECRSSISIPGPPETLQIFDVSRDGMTLTWY 31940

  Fly  6676 PPNDDGGSAIQNYIIEKKEARSSTWSKVSSF-CTVPFVRIRNLVLNKEYDFRVIAENKYGQSDPA 6739
            ||.|||||.:..||:|:||.|:..|.:|:.. .|:...|...|:...||:.||.|.|..|...|:
Mouse 31941 PPEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLIEGLEYEHRVTAINARGTGKPS 32005

  Fly  6740 NTSEPILARHPFDIPNTPGIPHGIDSTEDSITIAWTKPKHDGGSPITGYIIEKRLLSDDKWTKAV 6804
            ..|:|.:|..|...|..|..|...|:|..|:::||:.|:.:|||.:|||:||.:.:...:|||  
Mouse 32006 RPSKPTVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQREWTK-- 32068

  Fly  6805 HALCPDLSCKI-----PNLIENAEYEFRVAAVNAAGQSAYSGSSDLIFCRRPPHAP---KITSDL 6861
               |.....||     .:|.:.|||.|||.|.||.|..            .|...|   |:|..|
Mouse 32069 ---CNTTPTKIREYTLTHLPQGAEYRFRVLACNAGGPG------------EPAEVPGTVKVTEML 32118

  Fly  6862 SIRD----------MTVIAGDEFRITVPYHASPRPTASWSLNGLEVIPGERIKFDSNDYASMYYN 6916
            ...|          :.|..|...|:|:|....|.|...|:..|.::  .:|....:::..:....
Mouse 32119 EYPDYELDERYQEGVFVRQGGVIRLTIPIKGKPFPVCKWTKEGQDI--SKRAMIATSETHTELVI 32181

  Fly  6917 KSAKRDETGSYTITLTNNKGSDTASCHVTVVDRPLPPQGPLNAYDITPDTCTLAWKTPLDDGGSP 6981
            |.|.|:::|:|.:.|.|..|..|....|.|:..|..|:|||...||...:..::|:.|.||||:.
Mouse 32182 KEADRNDSGTYDLVLENKCGKKTVYIKVKVIGSPNTPEGPLEYDDIQARSVRVSWRPPADDGGAD 32246

  Fly  6982 ITNYVVEKLD-NSGSWVKISSFVRNTHYDVMGLEPHYKYNFRVRAENQYGLSDPLDIIEPIVAKH 7045
            |..|::|:.: ...:|..|.|.||.|...|.||:.:.:|:|||.||||:|:|.||...||::.|.
Mouse 32247 ILGYILERREVPKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVIPKT 32311

  Fly  7046 QFTVPDEPGQ-PKVIDWDSGNVTLIWTRPLSDGGSRIQGYQIEYRDILNDSSWNAYDYI-IKDTK 7108
            ....|:.|.. |:|:|....:|:|.|:||..|||||:.||.||.::...| .|..::.. |..|.
Mouse 32312 PLNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTD-KWVRHNKTQITTTM 32375

  Fly  7109 YQLYNLINGSEYEFRIKAKNAAGLSKPSSPSLRFKLKGKFTVPSPPGAPQVTRVGKNYVDLKWEK 7173
            |.:..|:..:||:|||.|:|..|||:.|..|.....|..|..||.||..::..:.|:.|.|:|||
Mouse 32376 YTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVTLQWEK 32440

  Fly  7174 PLRDGGSRITGYIIERRDIGGAVWVKCNDYNVLDTEYTVMNLIEMGDYEFRVFAVNSAGRSEPSL 7238
            |..|||..|.||.:|.|..|.:.|.|.|...:.|.::|:..|:|..:|||||||.|..|.|.|..
Mouse 32441 PECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDRQFTIGGLLEATEYEFRVFAENETGLSRPRR 32505

  Fly  7239 CTMPIKVCEVLGGKKPDWITRLQDKVAPFGKDYTLQCAASGKPSPTARWLRNGKE-IQMNGGRMT 7302
            ..|.:|. ::..|:.|.....:.|.....|:...|.|...|:|.|..:|.|.||| ||....:| 
Mouse 32506 TAMSVKT-KLTSGEAPGVRKEMADVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKM- 32568

  Fly  7303 CDSKDGVFRLHISNVQTG---DDGDYTCEAMNSLGFVNTSGYLKIGSPPIINRCPSELKLPE--- 7361
              |.||  |.|...|.|.   |:|.|||.|.|.:|.|.:|..|.:.:.|..:  |. ..|.|   
Mouse 32569 --SSDG--RTHTLTVMTDEQEDEGVYTCVATNEVGEVESSSKLLLQAAPQFH--PG-YPLKEKYY 32626

  Fly  7362 ---GDNSKIKIFYSGDQPLTVI-------LKKNNEVICDSNDDTHVKVNIFDDYVAIYIRNIV-K 7415
               |...::.:.|.| :|:..:       |.:|:|.|...|.         :.|..:.::|:. |
Mouse 32627 GAVGSTLRLHVMYIG-RPVPAMTWFHGQKLLQNSEKITIENT---------EHYTHLVMKNVQRK 32681

  Fly  7416 SDGGPYQIEFTNESGSATGEFYVHITGMPSAPTGPMGISYINKNSCMLNWRPPSYDGGLKVSHYV 7480
            :..|.|:::.:|..|:......|.|...|..||||:.|..:.|||.:::|:||:.|||..:::||
Mouse 32682 THAGKYKVQLSNAFGTVDATLDVEIQDKPDKPTGPIVIEALLKNSVVISWKPPADDGGSWITNYV 32746

  Fly  7481 IERKDV-SSPHWITVSSTCKDTAFNVQGLIENQEYIFRVMAVNENGMGPPLEGLNPIRAKDPIDP 7544
            :|:.:. ....|..|||....|...:..|.||..|.|||.|.|..|:..|||..:.:..|.|.:.
Mouse 32747 VEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISEPLEVASIVIIKSPFEK 32811

  Fly  7545 PSPPGSPQITEIGGDFVHLEWEKPESDGGAHIQGYWIDKREVGSNTWQRVNATICAANQINCINL 7609
            |..||.|.||.:..|...:.|:.|.|||||.|:.|::::||...|.|..|..........:..||
Mouse 32812 PGVPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLERREKKQNKWIAVTTEEIRETVFSVQNL 32876

  Fly  7610 IEGRQYEFRIFAQNVAGLSTESSASQAVKIIDPQAASP---PLIVKPLRDANCIQNHNAQFTCTI 7671
            |||.:||||:..:|:.|   ||..|:..:.:.|::..|   |...:.||:.|.....||...|.:
Mouse 32877 IEGLEYEFRVKCENLGG---ESEWSEISEPVTPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKV 32938

  Fly  7672 NGVPKPTISWYKGARE-ISNGARYHMYS-EGDNHFLNINDVFGEDADEYVCRAVNKAGAKSTRAT 7734
            .|.|||.:.||:..:| |::|.:|.:.. :|..|.|.|..|..:||..|..||.|:.|:.|..|:
Mouse 32939 TGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTAS 33003

  Fly  7735 LAIMTAPKLNVPPRFR--DTAYFDKGENVVIKIPFTGFPKPRIHWVRDGENIESGGHYTVEVKER 7797
            |.:....|:::|....  ...:..:||.|.|||||:|.|.|.|.|.:..:.|::.|||.|.|...
Mouse 33004 LEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRS 33068

  Fly  7798 HAVLIIRDG-SHLDSGPYRITAENELGSDTAIIQVQISDRPDPPRFPLIESIGTESLSLSWKAPV 7861
            ...|:..:| ...|:|.|.:.|:|..|.|...:::.::|.|||||...:..:..:|::|:|..|.
Mouse 33069 FTSLVFSNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPA 33133

  Fly  7862 WDGCSDITNYYVERREHPLSSWIRVGNTRFTSMAVSGLTPGKEYDFRIFADNVYGRSDASDTSTL 7926
            .||.|.:|||.||:.......|:|||..|.|...|..|.....|.||:.|:|.:|.|..|:.|..
Mouse 33134 SDGGSKVTNYIVEKCATTAERWLRVGQARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEP 33198

  Fly  7927 IKTKESVKKKPIERKWEIDANGRKLRGKADGPVKDYDSYVFDIYSKFVPQPVEISQQSVYDRYDI 7991
            ..|||. |.:.:....|:|........||.             :||         .:.:|::|.|
Mouse 33199 TVTKED-KTRAMNYDDEVDETREVTTTKAS-------------HSK---------TKELYEKYMI 33240

  Fly  7992 LEEIGTGAFGVVHRCRERSTGNIFAAKFIPVSHSVEKDLIRREIDIMNQLHHQKLINLHDAFEDD 8056
            .|::|.|.||:||||.|.|:...|.|||:.|. ..::.|:::||.|:|...|:.::.||::||..
Mouse 33241 AEDLGRGEFGIVHRCVETSSKRTFMAKFVKVK-GTDQVLVKKEISILNIARHRNILYLHESFESM 33304

  Fly  8057 DEMILILEFLSGGELFERITAEGYVMTEAEVINYMRQICEGIRHMHEQNIIHLDIKPENIMCQTR 8121
            :|:::|.||:||.::||||....:.:.|.|:::|:||:||.:..:|.|||.|.||:||||:.|||
Mouse 33305 EELVMIFEFISGLDIFERINTSAFELNEREIVSYVRQVCEALEFLHSQNIGHFDIRPENIIYQTR 33369

  Fly  8122 SSTNVKLIDFGLATRLDPNEVVKITTGTAEFAAPEIVNREPVGFYTDMWATGVLSYVLLSGLSPF 8186
            .::.:|:|:||.|.:|.|.:..::.....|:.|||:...:.|...||||:.|.|.||||||::||
Mouse 33370 KNSTIKIIEFGQARQLKPGDNFRLLFTAPEYYAPEVHQHDVVSTATDMWSLGTLVYVLLSGINPF 33434

  Fly  8187 AGDNDVQTLKNVKACDWDFDVESFKYISEEAKDFIRKLLVRNKEKRMTAHECLLHPWLTGDHSAM 8251
            ..:.:.|.::|:...::.||.|:||.||.||.||:.:|||:.::.||||.|.|.||||       
Mouse 33435 LAETNQQMIENIMNAEYTFDEEAFKEISLEAMDFVDRLLVKERKSRMTASEALQHPWL------- 33492

  Fly  8252 KQEINRDRYLAYREKLRRKY------EDFERFL--------------------------LPIGRL 8284
            ||.|:|......|....|:|      :|....:                          :.||.:
Mouse 33493 KQRIDRVSTKVIRTLKHRRYYHTLIKKDLNMVVSAARISCGGAIRSQRGVSVAKVKVASIEIGPV 33557

  Fly  8285 SE------------------------------YSSLRKL-LMEKYKI--HDAV----------FD 8306
            |.                              |..:|:| ..|||:|  .|.|          ||
Mouse 33558 SGQIMHAIGEEGGYVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVATMYVKDITKFD 33622

  Fly  8307 -----------------------------------------RRQAAPRFVIRPS-------SQFC 8323
                                                     ||..|.|.:.||.       ::..
Mouse 33623 DGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTKKVKRRTDAMRLLERPPEFTLPLYNKTA 33687

  Fly  8324 YEGQSVKFYCRCIAIATPTLTWSHNNIELRQSVKFMKRYVGDD------------YYFIINRVKL 8376
            |.|::|:|.........|.:||..:.    |.:|     .|||            |...||.|..
Mouse 33688 YVGENVRFGVTITVHPEPRVTWYKSG----QKIK-----PGDDEKKYTFESDKGLYQLTINSVTT 33743

  Fly  8377 DDRGEYIIRAENHYG--SREEVVFLNVQPLPKEQPRYRTESTPVRRREPLPYTFWQEESETAPSF 8439
            ||..||.:.|.|.:|  |.:..:.:.:.|.|.|     |...|:.:|     .....|.....|.
Mouse 33744 DDDAEYTVVARNKHGEDSCKAKLTVTLHPPPTE-----TTLRPMFKR-----LLANAECHEGQSV 33798

  Fly  8440 TFLLRPRVMQARDTCKLLCCLSGKPVPNVRWYKDGRELSKYEYAMTHSDGV--VTMEIIDCKPSD 8502
            .|.:|               :||.|.|.::|.|||:.||...:.....:|:  ..:.|.|..|.|
Mouse 33799 CFEIR---------------VSGIPAPTLKWEKDGQPLSLGPHIEIVHEGLDYYALHIRDTLPED 33848

  Fly  8503 SGKYSCKATNCHGTDETDC--------VVIVEGEWVTPEQAQ----------LAHNFLYSGDRKY 8549
            :|.|...|||..|:  |.|        :..|:.|:.:.|:.:          |....:.||....
Mouse 33849 TGYYRVTATNTAGS--TSCQAHLQVERLRYVKQEFQSKEERERHVQKQIDKTLRMAEILSGTETV 33911

  Fly  8550 IEQPI------------KPA-------------------------PLPIVTSRQYTSSSVQNTSE 8577
            ...|:            |||                         |..:...|::..::|:   |
Mouse 33912 PLTPVAQEALREAAILYKPAVSTKTVKGEYRLQTEEKKEERKLRMPYEVPEPRRFKQATVE---E 33973

  Fly  8578 PQGDKVNVSNSNSSGISNKKKYAS--NSLQAPGS------------------------------- 8609
            .|..|..|.      :|:.|.|..  :..:.||.                               
Mouse 33974 DQRIKQFVP------MSDMKWYKKIRDQYEMPGKLDRVVQKRPKRIRLSRWEQFYVMPLPRITDQ 34032

  Fly  8610 -------------------PSRSRS--------------------ATKELILPPDDSLMCK---- 8631
                               |:|.|:                    :.:||:||.||.|..|    
Mouse 34033 YRPKWRIPKLTQDDLEMVRPARRRTPSPDYDLYYYRRRRRSLGDMSDEELLLPIDDYLAMKRTEE 34097

  Fly  8632 ----------------------PEF--------TKPLH--------DL---TIH----------- 8644
                                  |.|        :.|.|        |.   |.|           
Mouse 34098 ERLRLEEELELGFSASPPSRSPPRFELSSLRYSSPPAHVKVEDRRRDFRYSTYHVPTKEETSTSY 34162

  Fly  8645 -------------------------DGEQLI---------------------------------- 8650
                                     :.|:|:                                  
Mouse 34163 AELRERHAQASYRQPKLRQRIMAEKEEEELLRPVTTTQRLSEYKSELDYMSKEEKSKKKSKRQRQ 34227

  Fly  8651 LTCYVKGDPEPQISWSKNGKSLSSSDILDLRYKNGIATLTINEVFPEDEGVIT------------ 8703
            :|...:.:.|.:||.....:|.||...| ||.:..::...|..:.|..|.:.:            
Mouse 34228 VTEITEIEEEYEISRRAQRESSSSVSRL-LRRRRSLSPTYIELMRPVSELIRSHPRPAEEYEDDA 34291

  Fly  8704 -----------------CTATNSVGAVETKCKLTI----QPLDKNINKRKVNAG----------- 8736
                             .::..|:...|...:..|    :.:...:..:|.:..           
Mouse 34292 ERRSPTPERTRPRSPSPVSSERSLSRFERSARFDIFSRYESMKAALKTQKTSERKYEVLSQQPFT 34356

  Fly  8737 -DNAPKIVSHLESRFVRDGDAVNLACRIIGAQHFDVVWLHNNKEIKPSKDFQYTNEANIYRLQIA 8800
             |:||:|...:.|..|..|........:......:|.|.||..|::.|....|||.:.:..|:|.
Mouse 34357 LDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEIL 34421

  Fly  8801 EIFPEDGGTYTCEAFNDIGESFSTCTINVT---------------VPGD---------------- 8834
            :...||||||.....|..||:....|::||               ||..                
Mouse 34422 DCQTEDGGTYRAVCTNYKGEASDYATLDVTGGAYTTYASQRRDEEVPKSVFPELTKTEAYAVSSF 34486

  Fly  8835 --------------------ETKQ-------------------------------------PSFV 8842
                                ||::                                     ...:
Mouse 34487 KRTSELEAASSVREVKSQMTETRESLSTYEHYASAEMKSATSEEKSLEEKATVRKIKTTLAARIL 34551

  Fly  8843 KFPTSVSVLEGEGTTFECEIDSE-LLNLVWLKDGKPIDETLPRYSFTKDGHRYSFAVAKCNMDDV 8906
            ..|.|::|.|||...|.|:.|.| :..:.||::|:.: .|..|:..|...::.:|.::.....|.
Mouse 34552 TKPRSITVHEGESARFSCDTDGEPVPTVTWLREGQVV-STSARHQVTTTKYKSTFEISSVQASDE 34615

  Fly  8907 GQYQAKAVSGKAESICAFSMNVHTA 8931
            |.|.....:...:....|::.|..|
Mouse 34616 GNYSVVVENSDGKQEAQFTLTVQKA 34640

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btNP_001162825.1 Ig 9..101 CDD:472250 19/74 (26%)
Ig strand B 26..30 CDD:409353
Ig strand C 39..43 CDD:409353 1/10 (10%)
Ig strand E 69..73 CDD:409353 1/3 (33%)
Ig strand F 83..88 CDD:409353 1/4 (25%)
Ig strand G 96..99 CDD:409353 1/2 (50%)
I-set 119..210 CDD:400151 19/92 (21%)
Ig strand B 136..140 CDD:409353 0/3 (0%)
Ig strand C 149..153 CDD:409353 0/3 (0%)
Ig strand E 174..182 CDD:409353 2/7 (29%)
Ig strand F 192..197 CDD:409353 1/4 (25%)
Ig strand G 205..208 CDD:409353 0/2 (0%)
Ig 228..320 CDD:472250 16/94 (17%)
Ig strand B 245..249 CDD:409353 0/3 (0%)
Ig strand C 258..262 CDD:409353 0/3 (0%)
Ig strand E 286..292 CDD:409353 1/5 (20%)
Ig strand F 302..307 CDD:409353 1/4 (25%)
Ig strand G 317..320 CDD:409353 0/2 (0%)
Ig 335..425 CDD:472250 26/127 (20%)
Ig strand B 350..354 CDD:409353 0/3 (0%)
Ig strand C 363..367 CDD:409353 2/7 (29%)
Ig strand E 393..397 CDD:409353 1/3 (33%)
Ig strand F 407..412 CDD:409353 1/4 (25%)
Ig strand G 420..423 CDD:409353 0/2 (0%)
Ig 438..532 CDD:472250 31/140 (22%)
Ig strand B 455..459 CDD:409353 1/3 (33%)
Ig strand C 468..472 CDD:409353 1/3 (33%)
Ig strand E 498..502 CDD:409353 2/3 (67%)
Ig strand F 512..517 CDD:409353 1/4 (25%)
Ig strand G 525..528 CDD:409353 1/2 (50%)
Ig 545..636 CDD:472250 19/172 (11%)
Ig strand B 560..564 CDD:409353 0/3 (0%)
Ig strand C 573..577 CDD:409353 1/3 (33%)
Ig strand E 599..606 CDD:409353 3/36 (8%)
Ig strand F 616..621 CDD:409353 0/4 (0%)
Ig strand G 629..632 CDD:409353 1/2 (50%)
Ig 656..726 CDD:472250 17/76 (22%)
Ig strand B 657..661 CDD:409353 2/10 (20%)
Ig strand C 670..674 CDD:409353 1/3 (33%)
Ig strand E 700..704 CDD:409353 1/3 (33%)
Ig strand F 714..719 CDD:409353 1/4 (25%)
Ig strand G 728..731 CDD:409353 0/3 (0%)
Ig 746..835 CDD:472250 24/98 (24%)
Ig strand C 777..781 CDD:409353 0/3 (0%)
Ig strand E 802..806 CDD:409353 2/3 (67%)
Ig strand F 816..821 CDD:409353 1/6 (17%)
Ig 1508..1588 CDD:472250 20/79 (25%)
Ig strand B 1514..1518 CDD:409353 0/3 (0%)
Ig strand C 1527..1531 CDD:409353 0/3 (0%)
Ig strand E 1554..1558 CDD:409353 2/3 (67%)
Ig strand F 1568..1573 CDD:409353 2/4 (50%)
Ig strand G 1581..1584 CDD:409353 1/2 (50%)
Ig 1639..1724 CDD:472250 20/116 (17%)
IG_like 1750..1821 CDD:214653 18/75 (24%)
Ig strand B 1750..1753 CDD:409353 1/2 (50%)
Ig strand C 1761..1765 CDD:409353 2/3 (67%)
Ig strand E 1788..1792 CDD:409353 0/3 (0%)
Ig strand F 1802..1806 CDD:409353 0/3 (0%)
Ig 1826..1909 CDD:472250 27/155 (17%)
Ig strand B 1842..1846 CDD:409353 1/9 (11%)
Ig strand C 1854..1858 CDD:409353 0/3 (0%)
Ig strand E 1879..1883 CDD:409353 1/3 (33%)
Ig 1914..1998 CDD:472250 25/165 (15%)
Ig 2020..2095 CDD:472250 20/104 (19%)
Ig strand B 2021..2025 CDD:409353 1/22 (5%)
Ig strand C 2038..2042 CDD:409353 0/3 (0%)
Ig strand E 2062..2066 CDD:409353 1/12 (8%)
Ig strand F 2076..2081 CDD:409353 1/4 (25%)
Ig strand G 2089..2092 CDD:409353 0/2 (0%)
FN3 2100..2194 CDD:238020 28/96 (29%)
FN3 2203..2292 CDD:238020 37/90 (41%)
Ig 2314..2395 CDD:472250 24/80 (30%)
Ig strand B 2322..2326 CDD:409353 0/3 (0%)
Ig strand C 2335..2339 CDD:409353 0/3 (0%)
Ig strand E 2361..2365 CDD:409353 0/3 (0%)
Ig strand F 2375..2380 CDD:409353 2/4 (50%)
FN3 <2376..2753 CDD:442628 139/479 (29%)
Ig strand G 2388..2391 CDD:409353 0/2 (0%)
FN3 2501..2590 CDD:238020 40/89 (45%)
FN3 <2673..>2891 CDD:442628 88/222 (40%)
Ig 2902..2995 CDD:472250 25/94 (27%)
Ig strand B 2920..2924 CDD:409353 1/3 (33%)
Ig strand C 2933..2937 CDD:409353 0/3 (0%)
FN3 <2957..>3191 CDD:442628 82/233 (35%)
Ig strand E 2961..2965 CDD:409353 1/3 (33%)
Ig strand F 2975..2980 CDD:409353 1/4 (25%)
Ig strand G 2988..2991 CDD:409353 1/2 (50%)
FN3 2999..3088 CDD:238020 34/88 (39%)
Ig 3212..3292 CDD:472250 20/79 (25%)
Ig strand B 3220..3224 CDD:409353 1/3 (33%)
Ig strand C 3233..3237 CDD:409353 0/3 (0%)
Ig strand E 3258..3262 CDD:409353 2/3 (67%)
Ig strand F 3272..3277 CDD:409353 2/4 (50%)
Ig strand G 3285..3288 CDD:409353 0/2 (0%)
FN3 3296..3390 CDD:238020 33/94 (35%)
FN3 3400..3489 CDD:238020 37/89 (42%)
I-set 3494..3590 CDD:400151 22/98 (22%)
Ig strand B 3517..3521 CDD:409353 0/3 (0%)
Ig strand C 3530..3534 CDD:409353 0/3 (0%)
Ig strand E 3556..3560 CDD:409353 1/3 (33%)
Ig strand F 3570..3575 CDD:409353 1/4 (25%)
Ig strand G 3583..3586 CDD:409353 0/2 (0%)
FN3 3594..3682 CDD:238020 38/88 (43%)
FN3 3694..3781 CDD:238020 36/186 (19%)
I-set 3795..3885 CDD:400151 21/94 (22%)
Ig strand B 3813..3817 CDD:409353 0/3 (0%)
Ig strand C 3826..3830 CDD:409353 1/3 (33%)
Ig strand E 3851..3855 CDD:409353 1/3 (33%)
Ig strand F 3865..3870 CDD:409353 1/4 (25%)
FN3 <3866..4181 CDD:442628 94/329 (29%)
Ig strand G 3878..3881 CDD:409353 0/2 (0%)
FN3 4185..4271 CDD:238020 29/86 (34%)
FN3 4285..4383 CDD:238020 43/196 (22%)
FN3 4356..4776 CDD:442628 150/534 (28%)
FN3 4779..4863 CDD:238020 26/84 (31%)
FN3 4879..4970 CDD:238020 32/92 (35%)
Ig_3 4978..5056 CDD:464046 21/86 (24%)
FN3 <5021..>5264 CDD:442628 88/242 (36%)
FN3 5073..5166 CDD:238020 36/92 (39%)
Ig 5286..5366 CDD:472250 24/79 (30%)
Ig strand B 5294..5298 CDD:409353 0/3 (0%)
Ig strand C 5307..5311 CDD:409353 0/3 (0%)
Ig strand E 5332..5336 CDD:409353 1/3 (33%)
Ig strand F 5346..5351 CDD:409353 3/4 (75%)
Ig strand G 5359..5362 CDD:409353 0/2 (0%)
FN3 5370..5462 CDD:238020 32/92 (35%)
FN3 5470..5561 CDD:238020 36/193 (19%)
Ig 5559..5654 CDD:472250 22/96 (23%)
Ig strand B 5588..5592 CDD:409353 0/3 (0%)
Ig strand C 5601..5605 CDD:409353 0/3 (0%)
Ig strand E 5626..5630 CDD:409353 1/3 (33%)
Ig strand F 5640..5645 CDD:409353 3/4 (75%)
FN3 5664..5755 CDD:238020 34/91 (37%)
FN3 5764..5853 CDD:238020 34/89 (38%)
Ig 5874..5954 CDD:472250 25/81 (31%)
Ig strand B 5882..5886 CDD:409353 1/3 (33%)
Ig strand C 5895..5899 CDD:409353 1/3 (33%)
Ig strand E 5920..5924 CDD:409353 0/3 (0%)
Ig strand F 5934..5939 CDD:409353 2/4 (50%)
Ig strand G 5947..5950 CDD:409353 0/2 (0%)
FN3 <5972..>6384 CDD:442628 144/514 (28%)
Ig_Titin_like 6174..6255 CDD:409406 27/80 (34%)
Ig strand A 6174..6178 CDD:409406 0/3 (0%)
Ig strand B 6183..6189 CDD:409406 1/5 (20%)
Ig strand C 6195..6201 CDD:409406 3/5 (60%)
Ig strand D 6213..6218 CDD:409406 1/4 (25%)
Ig strand E 6219..6225 CDD:409406 1/5 (20%)
Ig strand F 6234..6242 CDD:409406 5/7 (71%)
FN3 <6236..6552 CDD:442628 116/610 (19%)
Ig strand G 6245..6255 CDD:409406 2/9 (22%)
Ig_Titin_like 6570..6650 CDD:409406 22/79 (28%)
Ig strand A 6570..6573 CDD:409406 1/2 (50%)
Ig strand B 6578..6584 CDD:409406 0/5 (0%)
Ig strand C 6590..6596 CDD:409406 3/5 (60%)
Ig strand D 6608..6613 CDD:409406 0/4 (0%)
Ig strand E 6614..6620 CDD:409406 0/5 (0%)
Ig strand F 6629..6637 CDD:409406 4/7 (57%)
FN3 <6630..7006 CDD:442628 134/495 (27%)
Ig strand G 6640..6650 CDD:409406 4/9 (44%)
FN3 <6905..>7189 CDD:442628 107/286 (37%)
FN3 7151..7237 CDD:238020 37/85 (44%)
Ig 7254..7344 CDD:472250 34/93 (37%)
Ig strand B 7271..7275 CDD:409353 1/3 (33%)
Ig strand C 7284..7288 CDD:409353 0/3 (0%)
Ig strand E 7310..7314 CDD:409353 1/3 (33%)
Ig strand F 7324..7329 CDD:409353 3/4 (75%)
Ig strand G 7337..7340 CDD:409353 0/2 (0%)
Ig 7361..7438 CDD:472250 17/90 (19%)
Ig strand B 7365..7369 CDD:409353 0/3 (0%)
Ig strand C 7378..7382 CDD:409353 0/10 (0%)
Ig strand E 7406..7410 CDD:409353 0/3 (0%)
Ig strand F 7420..7425 CDD:409353 1/4 (25%)
FN3 <7421..7762 CDD:442628 116/348 (33%)
Ig strand G 7433..7436 CDD:409353 0/2 (0%)
I-set 7648..7737 CDD:400151 32/90 (36%)
Ig strand B 7665..7669 CDD:409353 1/3 (33%)
Ig strand C 7678..7682 CDD:409353 0/3 (0%)
Ig strand E 7703..7707 CDD:409353 2/3 (67%)
Ig strand F 7717..7722 CDD:409353 1/4 (25%)
Ig strand G 7730..7733 CDD:409353 1/2 (50%)
Ig 7758..7833 CDD:472250 28/75 (37%)
Ig strand B 7761..7765 CDD:409353 2/3 (67%)
Ig strand C 7774..7778 CDD:409353 1/3 (33%)
Ig strand E 7799..7803 CDD:409353 1/3 (33%)
Ig strand F 7813..7818 CDD:409353 1/4 (25%)
Ig strand G 7826..7829 CDD:409353 0/2 (0%)
FN3 7837..7927 CDD:238020 34/89 (38%)
STKc_Twitchin_like 7986..8244 CDD:271016 110/257 (43%)
Ig 8313..8401 CDD:472250 27/108 (25%)
Ig strand B 8329..8333 CDD:409541 2/3 (67%)
Ig strand C 8342..8346 CDD:409541 1/3 (33%)
Ig strand E 8367..8371 CDD:409541 1/3 (33%)
Ig strand F 8381..8386 CDD:409541 2/4 (50%)
Ig strand G 8394..8397 CDD:409541 0/2 (0%)
I-set 8437..8525 CDD:400151 26/97 (27%)
Ig strand B 8454..8458 CDD:409353 0/3 (0%)
Ig strand C 8467..8471 CDD:409353 0/3 (0%)
Ig strand E 8491..8495 CDD:409353 0/3 (0%)
Ig strand F 8505..8510 CDD:409353 1/4 (25%)
Ig strand G 8518..8521 CDD:409353 1/2 (50%)
I-set 8632..8721 CDD:400151 24/206 (12%)
Ig strand B 8649..8653 CDD:409570 1/37 (3%)
Ig strand C 8662..8666 CDD:409570 2/3 (67%)
Ig strand E 8687..8691 CDD:409570 0/3 (0%)
Ig strand F 8701..8706 CDD:409570 0/33 (0%)
Ig strand G 8714..8717 CDD:409570 1/2 (50%)
I-set 8740..8831 CDD:400151 28/105 (27%)
Ig strand B 8757..8761 CDD:409353 0/3 (0%)
Ig strand C 8770..8774 CDD:409353 1/3 (33%)
Ig strand E 8795..8799 CDD:409353 1/3 (33%)
Ig strand F 8809..8814 CDD:409353 2/4 (50%)
Ig strand G 8822..8825 CDD:409353 0/2 (0%)
Ig 8839..8922 CDD:472250 20/83 (24%)
Ig strand B 8856..8860 CDD:409353 1/3 (33%)
Ig strand C 8868..8872 CDD:409353 0/3 (0%)
Ig strand E 8894..8898 CDD:409353 1/3 (33%)
TtnNP_001372637.1 IgI_1_Titin_Z1z2-like 6..98 CDD:409566
Ig strand A 6..8 CDD:409566
Ig strand A' 11..16 CDD:409566
Ig strand B 23..31 CDD:409566
Ig strand C 36..40 CDD:409566
Ig strand C' 44..46 CDD:409566
Ig strand D 53..59 CDD:409566
Ig strand E 62..67 CDD:409566
Ig strand F 76..84 CDD:409566
Ig strand G 87..98 CDD:409566
IgI_2_Titin_Z1z2-like 103..193 CDD:409564
Ig strand A 103..106 CDD:409564
Ig strand A' 109..113 CDD:409564
Ig strand B 121..129 CDD:409564
Ig strand C 134..139 CDD:409564
Ig strand C' 142..144 CDD:409564
Ig strand D 150..155 CDD:409564
Ig strand E 158..163 CDD:409564
Ig strand F 172..180 CDD:409564
Ig strand G 183..193 CDD:409564
PRK12323 <253..>346 CDD:481241
PTZ00121 <413..725 CDD:173412
I-set 946..1035 CDD:400151
Ig strand B 963..967 CDD:409353
Ig strand C 976..980 CDD:409353
Ig strand E 1001..1005 CDD:409353
Ig strand F 1015..1020 CDD:409353
Ig strand G 1028..1031 CDD:409353
I-set 1084..1173 CDD:400151
Ig strand B 1101..1105 CDD:409405
Ig strand C 1114..1118 CDD:409405
Ig strand E 1141..1145 CDD:409405
Ig strand F 1155..1160 CDD:409405
Ig strand G 1168..1171 CDD:409405
Ig 1295..1383 CDD:472250
Ig strand B 1310..1314 CDD:409474
Ig strand C 1323..1327 CDD:409474
Ig strand E 1349..1353 CDD:409474
Ig strand F 1363..1368 CDD:409474
Ig strand G 1376..1379 CDD:409474
Ig 1463..1553 CDD:472250
Ig strand B 1480..1484 CDD:409405
Ig strand C 1493..1497 CDD:409405
Ig strand E 1519..1523 CDD:409405
Ig strand F 1533..1538 CDD:409405
Ig strand G 1546..1549 CDD:409405
Ig 1562..1653 CDD:472250
Ig strand B 1579..1583 CDD:409543
Ig strand C 1592..1596 CDD:409543
Ig strand E 1619..1623 CDD:409543
Ig strand F 1633..1638 CDD:409543
Ig strand G 1646..1649 CDD:409543
Ig <1728..1800 CDD:472250
Ig strand C 1741..1745 CDD:409353
Ig strand E 1766..1770 CDD:409353
Ig strand F 1780..1785 CDD:409353
Ig strand G 1793..1796 CDD:409353
I-set 1847..1935 CDD:400151
Ig strand B 1864..1868 CDD:409543
Ig strand C 1877..1881 CDD:409543
Ig strand E 1901..1905 CDD:409543
Ig strand F 1915..1920 CDD:409543
Ig strand G 1928..1931 CDD:409543
IgI_titin_I1-like 2084..2175 CDD:409543
Ig strand A 2084..2086 CDD:409543
Ig strand A' 2088..2094 CDD:409543
Ig strand B 2101..2108 CDD:409543
Ig strand C 2114..2119 CDD:409543
Ig strand C' 2121..2124 CDD:409543
Ig strand D 2130..2134 CDD:409543
Ig strand E 2139..2146 CDD:409543
Ig strand F 2153..2161 CDD:409543
Ig strand G 2164..2175 CDD:409543
Ig 2182..2268 CDD:472250
Ig strand B 2198..2202 CDD:409559
Ig strand C 2210..2214 CDD:409559
Ig strand E 2235..2239 CDD:409559
Ig strand F 2249..2253 CDD:409559
Ig 2274..2358 CDD:472250
Ig strand B 2290..2294 CDD:409405
Ig strand C 2299..2306 CDD:409405
Ig strand E 2327..2331 CDD:409405
Ig 2363..2434 CDD:472250
Ig strand B 2379..2383 CDD:409405
Ig strand C 2391..2395 CDD:409405
Ig strand E 2416..2420 CDD:409405
Ig strand F 2430..2434 CDD:409405
Ig 2453..2536 CDD:472250
Ig strand B 2468..2472 CDD:409559
Ig strand C 2481..2485 CDD:409559
Ig strand E 2506..2510 CDD:409559
Ig strand F 2520..2525 CDD:409559
Ig strand G 2529..2532 CDD:409559
Ig 2540..2623 CDD:472250
Ig strand C 2568..2572 CDD:409559
Ig strand E 2593..2597 CDD:409559
Ig strand F 2607..2612 CDD:409559
Ig strand G 2616..2619 CDD:409559
Ig 2628..2710 CDD:472250
Ig strand C 2655..2659 CDD:409559
Ig strand E 2680..2684 CDD:409559
Ig strand F 2694..2699 CDD:409559
Ig strand G 2703..2706 CDD:409559
Ig 2714..2798 CDD:472250
Ig strand B 2730..2734 CDD:409543
Ig strand C 2743..2747 CDD:409543
Ig strand E 2768..2772 CDD:409543
Ig strand F 2782..2787 CDD:409543
Ig strand G 2791..2794 CDD:409543
Ig 2802..2885 CDD:472250
Ig strand B 2818..2822 CDD:409405
Ig strand C 2831..2834 CDD:409405
Ig strand E 2855..2859 CDD:409405
Ig strand F 2869..2874 CDD:409405
Ig strand G 2878..2881 CDD:409405
Ig 2889..2972 CDD:472250
Ig strand B 2905..2909 CDD:409543
Ig strand C 2918..2921 CDD:409543
Ig strand E 2942..2946 CDD:409543
Ig strand F 2956..2961 CDD:409543
Ig strand G 2965..2968 CDD:409543
Ig 2977..3059 CDD:472250
Ig strand B 2992..2996 CDD:409543
Ig strand C 3004..3008 CDD:409543
Ig strand E 3029..3033 CDD:409543
Ig strand F 3043..3048 CDD:409543
Ig strand G 3052..3055 CDD:409543
I-set 3065..3148 CDD:400151
Ig strand B 3081..3085 CDD:409543
Ig strand C 3093..3097 CDD:409543
Ig strand E 3118..3122 CDD:409543
Ig strand F 3132..3137 CDD:409543
Ig strand G 3141..3144 CDD:409543
Ig 3159..3239 CDD:472250
Ig strand B 3170..3174 CDD:409559
Ig strand C 3182..3186 CDD:409559
Ig strand E 3207..3213 CDD:409559
Ig strand F 3223..3228 CDD:409559
Ig strand G 3232..3235 CDD:409559
Ig 3245..3335 CDD:472250
Ig strand B 3262..3266 CDD:409543
Ig strand C 3275..3279 CDD:409543
Ig strand E 3300..3304 CDD:409543
Ig strand F 3314..3319 CDD:409543
Ig strand G 3327..3330 CDD:409543
I-set 3351..3437 CDD:400151
Ig strand B 3368..3372 CDD:409353
Ig strand C 3380..3384 CDD:409353
Ig strand E 3405..3409 CDD:409353
Ig strand F 3419..3424 CDD:409353
Ig strand G 3432..3435 CDD:409353
I-set 3471..3562 CDD:400151
Ig strand B 3488..3492 CDD:409543
Ig strand C 3501..3505 CDD:409543
Ig strand E 3528..3532 CDD:409543
Ig strand F 3542..3547 CDD:409543
Ig strand G 3555..3558 CDD:409543
I-set 3634..3721 CDD:400151
Ig strand B 3651..3655 CDD:409405
Ig strand C 3664..3668 CDD:409405
Ig strand E 3689..3693 CDD:409405
Ig strand F 3703..3708 CDD:409405
Ig strand G 3716..3719 CDD:409405
I-set 3750..3840 CDD:400151
Ig strand B 3767..3771 CDD:409353
Ig strand C 3780..3784 CDD:409353
Ig strand E 3806..3810 CDD:409353
Ig strand F 3820..3825 CDD:409353
Ig strand G 3833..3836 CDD:409353
Ig 4376..4463 CDD:472250
Ig strand B 4393..4397 CDD:409405
Ig strand C 4404..4408 CDD:409405
Ig strand E 4429..4433 CDD:409405
Ig strand F 4443..4448 CDD:409405
Ig strand G 4456..4459 CDD:409405
I-set 4469..4558 CDD:400151
Ig strand B 4486..4490 CDD:409543
Ig strand C 4499..4503 CDD:409543
Ig strand E 4524..4528 CDD:409543
Ig strand F 4538..4543 CDD:409543
Ig strand G 4551..4554 CDD:409543
I-set 4564..4653 CDD:400151
Ig strand B 4581..4585 CDD:409405
Ig strand C 4594..4598 CDD:409405
Ig strand E 4619..4623 CDD:409405
Ig strand F 4633..4638 CDD:409405
Ig strand G 4646..4649 CDD:409405
Ig 4657..4730 CDD:472250
Ig strand B 4674..4678 CDD:409353
Ig strand C 4687..4691 CDD:409353
Ig strand E 4712..4716 CDD:409353
Ig strand F 4726..4730 CDD:409353
I-set 4750..4840 CDD:400151
Ig strand B 4768..4772 CDD:409353
Ig strand C 4781..4785 CDD:409353
Ig strand E 4806..4810 CDD:409353
Ig strand F 4820..4825 CDD:409353
I-set 4844..4930 CDD:400151
Ig strand B 4861..4865 CDD:409353
Ig strand C 4874..4878 CDD:409353
Ig strand E 4899..4903 CDD:409353
Ig strand F 4913..4918 CDD:409353
I-set 4937..5026 CDD:400151
Ig strand B 4954..4958 CDD:409353
Ig strand C 4967..4971 CDD:409353
Ig strand E 4992..4996 CDD:409353
Ig strand F 5006..5011 CDD:409353
Ig strand G 5019..5022 CDD:409353
I-set 5039..5119 CDD:400151
Ig strand B 5047..5051 CDD:409353
Ig strand C 5060..5064 CDD:409353
Ig strand E 5085..5089 CDD:409353
Ig strand F 5099..5104 CDD:409353
Ig strand G 5113..5116 CDD:409353
I-set 5126..5215 CDD:400151
Ig strand B 5144..5147 CDD:409353
Ig strand C 5156..5160 CDD:409353
Ig strand E 5181..5185 CDD:409353
Ig strand F 5195..5200 CDD:409353
Ig strand G 5209..5212 CDD:409353
I-set 5219..5308 CDD:400151
Ig strand B 5236..5240 CDD:409353
Ig strand C 5249..5253 CDD:409353
Ig strand E 5274..5278 CDD:409353
Ig strand F 5288..5293 CDD:409353
Ig strand G 5301..5304 CDD:409353
I-set 5314..5402 CDD:400151
Ig strand B 5330..5334 CDD:409405
Ig strand C 5343..5347 CDD:409405
Ig strand E 5369..5372 CDD:409405
Ig strand F 5382..5387 CDD:409405
I-set 5406..5494 CDD:400151
Ig strand B 5423..5427 CDD:409353
Ig strand C 5436..5440 CDD:409353
Ig strand E 5461..5465 CDD:409353
Ig strand F 5475..5480 CDD:409353
Ig 5499..5588 CDD:472250
Ig strand C 5529..5533 CDD:409353
Ig strand E 5554..5558 CDD:409353
Ig strand F 5568..5573 CDD:409353
Ig 5600..5681 CDD:472250
Ig strand B 5609..5613 CDD:409406
Ig strand C 5622..5626 CDD:409406
Ig strand E 5647..5651 CDD:409406
Ig strand F 5661..5666 CDD:409406
Ig strand G 5676..5679 CDD:409406
I-set 5688..5777 CDD:400151
Ig strand C 5718..5722 CDD:409353
Ig strand E 5743..5747 CDD:409353
Ig strand F 5757..5762 CDD:409353
Ig 5781..5870 CDD:472250
Ig strand B 5798..5802 CDD:409353
Ig strand C 5811..5815 CDD:409353
Ig strand E 5836..5840 CDD:409353
Ig strand F 5850..5855 CDD:409353
Ig strand G 5863..5866 CDD:409353
I-set 5874..5964 CDD:400151
Ig strand B 5893..5896 CDD:409353
Ig strand C 5905..5909 CDD:409353
Ig strand E 5930..5934 CDD:409353
Ig strand F 5944..5949 CDD:409353
Ig strand G 5957..5960 CDD:409353
I-set 5968..6056 CDD:400151
Ig strand B 5985..5989 CDD:409543
Ig strand C 5998..6002 CDD:409543
Ig strand E 6023..6027 CDD:409543
Ig strand F 6037..6042 CDD:409543
Ig strand G 6050..6053 CDD:409543
I-set 6061..6150 CDD:400151
Ig strand B 6078..6082 CDD:409353
Ig strand C 6091..6095 CDD:409353
Ig strand E 6116..6120 CDD:409353
Ig strand F 6130..6135 CDD:409353
I-set 6155..6243 CDD:400151
Ig strand B 6171..6175 CDD:409353
Ig strand C 6184..6188 CDD:409353
Ig strand E 6209..6213 CDD:409353
Ig strand F 6223..6228 CDD:409353
I-set 6250..6339 CDD:400151
Ig strand B 6267..6271 CDD:409353
Ig strand C 6280..6284 CDD:409353
Ig strand E 6305..6309 CDD:409353
Ig strand F 6319..6324 CDD:409353
Ig strand G 6332..6335 CDD:409353
I-set 6343..6432 CDD:400151
Ig strand B 6360..6364 CDD:409353
Ig strand C 6373..6377 CDD:409353
Ig strand E 6398..6402 CDD:409353
Ig strand F 6412..6417 CDD:409353
Ig strand G 6425..6428 CDD:409353
I-set 6436..6526 CDD:400151
Ig strand B 6454..6458 CDD:409405
Ig strand C 6467..6471 CDD:409405
Ig strand E 6492..6496 CDD:409405
Ig strand F 6506..6511 CDD:409405
Ig strand G 6519..6522 CDD:409405
I-set 6530..6618 CDD:400151
Ig strand B 6547..6551 CDD:409353
Ig strand C 6560..6564 CDD:409353
Ig strand E 6585..6589 CDD:409353
Ig strand F 6599..6604 CDD:409353
I-set 6623..6713 CDD:400151
Ig strand B 6640..6644 CDD:409419
Ig strand C 6653..6657 CDD:409419
Ig strand E 6679..6683 CDD:409419
Ig strand F 6693..6698 CDD:409419
Ig strand G 6706..6709 CDD:409419
I-set 6718..6806 CDD:400151
Ig strand C 6747..6751 CDD:409353
Ig strand E 6772..6776 CDD:409353
Ig strand F 6786..6791 CDD:409353
Ig strand G 6800..6803 CDD:409353
I-set 6813..6902 CDD:400151
Ig strand C 6843..6847 CDD:409353
Ig strand E 6868..6872 CDD:409353
Ig strand F 6882..6887 CDD:409353
I-set 6906..6995 CDD:400151
Ig strand B 6923..6927 CDD:409353
Ig strand C 6936..6940 CDD:409353
Ig strand E 6961..6965 CDD:409353
Ig strand F 6975..6980 CDD:409353
Ig strand G 6988..6991 CDD:409353
I-set 7001..7086 CDD:400151
Ig strand B 7016..7020 CDD:409353
Ig strand C 7029..7033 CDD:409353
Ig strand E 7054..7058 CDD:409353
Ig strand F 7068..7073 CDD:409353
I-set 7092..7173 CDD:400151
Ig strand B 7109..7113 CDD:409353
Ig strand C 7122..7126 CDD:409353
Ig strand E 7147..7151 CDD:409353
Ig strand F 7161..7166 CDD:409353
Ig strand G 7175..7178 CDD:409353
I-set 7188..7276 CDD:400151
Ig strand B 7205..7209 CDD:409353
Ig strand C 7218..7222 CDD:409353
Ig strand E 7243..7247 CDD:409353
Ig strand F 7257..7262 CDD:409353
I-set 7284..7373 CDD:400151
Ig strand B 7301..7305 CDD:409405
Ig strand C 7314..7318 CDD:409405
Ig strand E 7340..7343 CDD:409405
Ig strand F 7353..7358 CDD:409405
Ig strand G 7366..7369 CDD:409405
I-set 7377..7467 CDD:400151
Ig strand B 7395..7399 CDD:409353
Ig strand C 7408..7412 CDD:409353
Ig strand E 7433..7437 CDD:409353
Ig strand F 7447..7452 CDD:409353
Ig strand G 7460..7463 CDD:409353
I-set 7471..7559 CDD:400151
Ig strand B 7488..7492 CDD:409353
Ig strand C 7501..7505 CDD:409353
Ig strand E 7526..7530 CDD:409353
Ig strand F 7540..7545 CDD:409353
I-set 7564..7654 CDD:400151
Ig strand B 7581..7585 CDD:409419
Ig strand C 7594..7598 CDD:409419
Ig strand E 7620..7624 CDD:409419
Ig strand F 7634..7639 CDD:409419
Ig strand G 7647..7650 CDD:409419
I-set 7660..7747 CDD:400151
Ig strand B 7675..7679 CDD:409353
Ig strand C 7688..7692 CDD:409353
Ig strand E 7713..7717 CDD:409353
Ig strand F 7727..7732 CDD:409353
I-set 7754..7843 CDD:400151
Ig strand B 7771..7775 CDD:409353
Ig strand C 7784..7788 CDD:409353
Ig strand E 7809..7813 CDD:409353
Ig strand F 7823..7828 CDD:409353
Ig strand G 7836..7839 CDD:409353
I-set 7847..7936 CDD:400151
Ig strand B 7864..7868 CDD:409353
Ig strand C 7877..7881 CDD:409353
Ig strand E 7902..7906 CDD:409353
Ig strand F 7916..7921 CDD:409353
Ig strand G 7929..7932 CDD:409353
Ig 7942..8029 CDD:472250
Ig strand B 7957..7961 CDD:409543
Ig strand C 7970..7974 CDD:409543
Ig strand E 7995..7999 CDD:409543
Ig strand F 8009..8014 CDD:409543
Ig strand G 8022..8025 CDD:409543
I-set 8033..8122 CDD:400151
Ig strand B 8050..8054 CDD:409353
Ig strand C 8063..8067 CDD:409353
Ig strand E 8088..8092 CDD:409353
Ig strand F 8102..8107 CDD:409353
Ig strand G 8116..8119 CDD:409353
I-set 8129..8217 CDD:400151
Ig strand B 8146..8150 CDD:409353
Ig strand C 8159..8163 CDD:409353
Ig strand E 8184..8188 CDD:409353
Ig strand F 8198..8203 CDD:409353
I-set 8225..8314 CDD:400151
Ig strand B 8242..8246 CDD:409405
Ig strand C 8255..8259 CDD:409405
Ig strand E 8280..8284 CDD:409405
Ig strand F 8294..8299 CDD:409405
Ig strand G 8307..8310 CDD:409405
Ig 8318..8395 CDD:472250
Ig strand C 8349..8353 CDD:409353
Ig strand E 8374..8378 CDD:409353
Ig strand F 8388..8393 CDD:409353
I-set 8412..8500 CDD:400151
Ig strand B 8429..8433 CDD:409353
Ig strand C 8442..8446 CDD:409353
Ig strand E 8467..8471 CDD:409353
Ig strand F 8481..8486 CDD:409353
I-set 8505..8595 CDD:400151
Ig strand B 8522..8526 CDD:409353
Ig strand C 8535..8539 CDD:409353
Ig strand E 8561..8565 CDD:409353
Ig strand F 8575..8580 CDD:409353
Ig strand G 8588..8591 CDD:409353
I-set 8601..8688 CDD:400151
Ig strand B 8617..8620 CDD:409353
Ig strand C 8629..8633 CDD:409353
Ig strand E 8654..8658 CDD:409353
Ig strand F 8668..8673 CDD:409353
I-set 8695..8784 CDD:400151
Ig strand B 8712..8716 CDD:409353
Ig strand C 8725..8729 CDD:409353
Ig strand E 8750..8754 CDD:409353
Ig strand F 8764..8769 CDD:409353
Ig strand G 8777..8780 CDD:409353
I-set 8788..8877 CDD:400151
Ig strand B 8805..8809 CDD:409353
Ig strand C 8818..8822 CDD:409353
Ig strand E 8843..8847 CDD:409353
Ig strand F 8857..8862 CDD:409353
I-set 8883..8967 CDD:400151
Ig strand B 8898..8902 CDD:409406
Ig strand C 8911..8915 CDD:409406
Ig strand E 8936..8940 CDD:409406
Ig strand F 8950..8955 CDD:409406
I-set 8974..9063 CDD:400151
Ig strand B 8991..8995 CDD:409353
Ig strand C 9004..9008 CDD:409353
Ig strand E 9029..9033 CDD:409353
Ig strand F 9043..9048 CDD:409353
Ig strand G 9057..9060 CDD:409353
I-set 9070..9158 CDD:400151
Ig strand B 9087..9091 CDD:409353
Ig strand C 9100..9104 CDD:409353
Ig strand E 9125..9129 CDD:409353
Ig strand F 9139..9144 CDD:409353
Ig strand G 9152..9155 CDD:409353
I-set 9166..9255 CDD:400151
Ig strand B 9183..9187 CDD:409353
Ig strand C 9196..9200 CDD:409353
Ig strand E 9221..9225 CDD:409353
Ig strand F 9235..9240 CDD:409353
Ig strand G 9248..9251 CDD:409353
Ig 9262..9352 CDD:472250
Ig strand B 9280..9284 CDD:409543
Ig strand C 9293..9297 CDD:409543
Ig strand E 9318..9322 CDD:409543
Ig strand F 9332..9337 CDD:409543
Ig strand G 9345..9348 CDD:409543
I-set 9359..9448 CDD:400151
Ig strand B 9376..9380 CDD:409353
Ig strand C 9389..9393 CDD:409353
Ig strand E 9414..9418 CDD:409353
Ig strand F 9428..9433 CDD:409353
Ig strand G 9441..9444 CDD:409353
I-set 9469..9557 CDD:400151
Ig strand B 9484..9488 CDD:409543
Ig strand C 9497..9501 CDD:409543
Ig strand E 9523..9527 CDD:409543
Ig strand F 9537..9542 CDD:409543
Ig strand G 9550..9553 CDD:409543
THB 9591..9621 CDD:465725
Ig 9675..9755 CDD:472250
Ig strand C 9700..9704 CDD:409353
Ig strand E 9725..9729 CDD:409353
Ig 9758..9840 CDD:472250
Ig strand B 9775..9779 CDD:409405
Ig strand C 9787..9791 CDD:409405
Ig strand E 9812..9816 CDD:409405
Ig strand G 9835..9838 CDD:409405
I-set 9848..9934 CDD:400151
Ig strand B 9864..9868 CDD:409543
Ig strand C 9876..9880 CDD:409543
Ig strand E 9901..9905 CDD:409543
Ig strand F 9915..9920 CDD:409543
Ig strand G 9929..9932 CDD:409543
PTZ00121 <10208..10736 CDD:173412
PTZ00449 <11550..11841 CDD:185628
PHA03247 <11702..12305 CDD:223021
PRK10263 <12181..>12511 CDD:236669
Ig 13103..13194 CDD:472250
Ig strand B 13123..13127 CDD:409353
Ig strand C 13136..13139 CDD:409353
Ig strand E 13160..13164 CDD:409353
Ig strand F 13174..13179 CDD:409353
IG_like 13207..13277 CDD:214653
IG_like 13300..>13364 CDD:214653
Ig 13475..13557 CDD:472250
Ig strand B 13490..13494 CDD:409353
Ig strand C 13502..13505 CDD:409353
Ig strand E 13527..13530 CDD:409353
Ig 13562..13645 CDD:472250
Ig strand B 13578..13582 CDD:409543
Ig strand C 13590..13594 CDD:409543
Ig strand E 13615..13619 CDD:409543
Ig strand F 13629..13634 CDD:409543
Ig strand G 13638..13641 CDD:409543
Ig 13650..13733 CDD:472250
Ig strand B 13667..13671 CDD:409559
Ig strand C 13678..13682 CDD:409559
Ig strand E 13703..13707 CDD:409559
Ig strand F 13717..13722 CDD:409559
Ig strand G 13726..13729 CDD:409559
Ig 13739..13822 CDD:472250
Ig strand B 13755..13759 CDD:409543
Ig strand C 13767..13771 CDD:409543
Ig strand E 13792..13796 CDD:409543
Ig strand F 13806..13811 CDD:409543
Ig strand G 13815..13818 CDD:409543
Ig 13829..13903 CDD:472250
Ig strand B 13844..13848 CDD:409543
Ig strand C 13856..13860 CDD:409543
Ig strand E 13881..13885 CDD:409543
Ig strand F 13895..13900 CDD:409543
Ig 13917..14000 CDD:472250
Ig 14005..14089 CDD:472250
Ig strand B 14022..14026 CDD:409353
Ig strand C 14035..14038 CDD:409353
Ig strand E 14059..14063 CDD:409353
Ig strand G 14082..14085 CDD:409353
Ig 14095..14178 CDD:472250
Ig 14186..14257 CDD:472250
Ig strand B 14200..14204 CDD:409559
Ig strand C 14212..14216 CDD:409559
Ig strand E 14237..14241 CDD:409559
Ig strand F 14251..14256 CDD:409559
Ig strand G 14260..14263 CDD:409559
Ig 14273..14356 CDD:472250
Ig strand B 14289..14293 CDD:409543
Ig strand C 14301..14305 CDD:409543
Ig strand E 14326..14330 CDD:409543
Ig strand F 14340..14345 CDD:409543
Ig strand G 14349..14352 CDD:409543
Ig 14362..14433 CDD:472250
Ig strand B 14378..14382 CDD:409543
Ig strand C 14390..14394 CDD:409543
Ig strand E 14415..14419 CDD:409543
Ig strand F 14429..14433 CDD:409543
IG_like 14458..14522 CDD:214653
Ig strand B 14467..14471 CDD:409559
Ig strand C 14479..14483 CDD:409559
Ig strand E 14504..14508 CDD:409559
Ig strand F 14518..14523 CDD:409559
Ig strand G 14527..14530 CDD:409559
Ig 14540..14623 CDD:472250
Ig strand B 14556..14560 CDD:409390
Ig strand C 14568..14572 CDD:409390
Ig strand E 14593..14597 CDD:409390
Ig strand G 14616..14619 CDD:409390
Ig 14629..14717 CDD:472250
Ig strand B 14644..14648 CDD:409543
Ig strand C 14656..14660 CDD:409543
Ig strand E 14681..14685 CDD:409543
Ig strand F 14695..14700 CDD:409543
Ig strand G 14709..14712 CDD:409543
Ig 14722..14805 CDD:472250
Ig strand B 14738..14742 CDD:409405
Ig strand C 14750..14754 CDD:409405
Ig strand E 14775..14779 CDD:409405
Ig strand F 14789..14794 CDD:409405
Ig strand G 14798..14801 CDD:409405
Ig 14811..14894 CDD:472250
Ig strand B 14827..14831 CDD:409543
Ig strand C 14839..14843 CDD:409543
Ig strand E 14864..14868 CDD:409543
Ig strand F 14878..14883 CDD:409543
Ig strand G 14887..14890 CDD:409543
Ig 14900..14982 CDD:472250
Ig 14996..15073 CDD:472250
Ig strand B 15004..15008 CDD:409406
Ig strand C 15017..15021 CDD:409406
Ig strand E 15039..15043 CDD:409406
Ig strand F 15053..15058 CDD:409406
Ig strand G 15066..15069 CDD:409406
FN3 <15092..>15437 CDD:442628
FN3 <15469..15848 CDD:442628
FN3 15752..16205 CDD:442628
FN3 <16075..>16361 CDD:442628
Ig 16383..16463 CDD:472250
Ig strand B 16391..16395 CDD:409406
Ig strand C 16404..16408 CDD:409406
Ig strand E 16429..16433 CDD:409406
Ig strand F 16443..16448 CDD:409406
Ig strand G 16456..16459 CDD:409406
FN3 16467..16553 CDD:238020
FN3 16572..16659 CDD:238020
Ig 16678..16785 CDD:472250
Ig strand B 16684..16688 CDD:409406
Ig strand C 16697..16701 CDD:409406
Ig strand E 16751..16755 CDD:409406
Ig strand F 16765..16770 CDD:409406
Ig strand G 16778..16781 CDD:409406
FN3 16789..16880 CDD:238020
FN3 16890..16982 CDD:238020
FN3 16996..17082 CDD:238020
FN3 <17115..17477 CDD:442628
FN3 17282..17374 CDD:238020
FN3 17453..>17789 CDD:442628
Ig_Titin_like 17806..17895 CDD:409406
Ig strand A 17806..17810 CDD:409406
Ig strand B 17815..17821 CDD:409406
Ig strand C 17827..17833 CDD:409406
Ig strand D 17853..17858 CDD:409406
Ig strand E 17859..17865 CDD:409406
Ig strand F 17874..17882 CDD:409406
Ig strand G 17885..17895 CDD:409406
FN3 17899..17991 CDD:238020
FN3 18004..18093 CDD:238020
Ig 18115..18200 CDD:472250
Ig strand B 18121..18125 CDD:409406
Ig strand C 18134..18143 CDD:409406
Ig strand E 18166..18170 CDD:409406
Ig strand F 18180..18185 CDD:409406
Ig strand G 18193..18196 CDD:409406
FN3 18204..18296 CDD:238020
FN3 18304..18401 CDD:238020
FN3 18415..18500 CDD:238020
Ig_Titin_like 18520..18599 CDD:409406
Ig strand A 18520..18524 CDD:409406
Ig strand B 18529..18535 CDD:409406
Ig strand C 18541..18547 CDD:409406
Ig strand D 18557..18562 CDD:409406
Ig strand E 18563..18569 CDD:409406
Ig strand F 18578..18586 CDD:409406
FN3 <18580..18983 CDD:442628
Ig strand G 18589..18599 CDD:409406
FN3 18704..18797 CDD:238020
FN3 <18919..>19190 CDD:442628
Ig 19216..19293 CDD:472250
Ig strand B 19223..19227 CDD:409406
Ig strand C 19236..19240 CDD:409406
Ig strand E 19259..19263 CDD:409406
Ig strand F 19273..19278 CDD:409406
Ig strand G 19286..19289 CDD:409406
FN3 19297..19384 CDD:238020
FN3 19397..19486 CDD:238020
FN3 19492..19982 CDD:442628
FN3 19989..20079 CDD:238020
FN3 20088..20181 CDD:238020
Ig 20188..20281 CDD:472250
Ig strand B 20206..20210 CDD:409353
Ig strand C 20219..20223 CDD:409353
Ig strand E 20246..20250 CDD:409353
Ig strand F 20260..20265 CDD:409353
Ig strand G 20273..20276 CDD:409353
FN3 20284..20375 CDD:238020
FN3 20383..20476 CDD:238020
FN3 20484..20582 CDD:238020
Ig_Titin_like 20603..20682 CDD:409406
Ig strand A 20603..20606 CDD:409406
Ig strand B 20611..20617 CDD:409406
Ig strand C 20623..20629 CDD:409406
Ig strand D 20640..20645 CDD:409406
Ig strand E 20646..20652 CDD:409406
Ig strand F 20661..20669 CDD:409406
Ig strand G 20672..20682 CDD:409406
FN3 20686..20772 CDD:238020
FN3 20786..20869 CDD:238020
Ig 20895..20975 CDD:472250
Ig strand B 20903..20907 CDD:409406
Ig strand C 20916..20920 CDD:409406
FN3 20926..>21321 CDD:442628
Ig strand E 20941..20945 CDD:409406
Ig strand F 20955..20960 CDD:409406
Ig strand G 20968..20971 CDD:409406
FN3 21079..21172 CDD:238020
Ig 21292..21372 CDD:472250
Ig strand B 21300..21304 CDD:409406
Ig strand C 21313..21317 CDD:409406
Ig strand E 21338..21342 CDD:409406
Ig strand F 21352..21357 CDD:409406
Ig strand G 21365..21368 CDD:409406
FN3 21376..21467 CDD:238020
FN3 21475..21567 CDD:238020
FN3 21576..21664 CDD:238020
Ig_Titin_like 21689..21770 CDD:409406
Ig strand A 21689..21693 CDD:409406
Ig strand B 21698..21704 CDD:409406
Ig strand C 21710..21716 CDD:409406
Ig strand D 21728..21733 CDD:409406
Ig strand E 21734..21740 CDD:409406
Ig strand F 21749..21757 CDD:409406
Ig strand G 21760..21770 CDD:409406
FN3 21774..21865 CDD:238020
FN3 21871..21955 CDD:238020
Ig_Titin_like 21978..22059 CDD:409406
Ig strand A 21978..21982 CDD:409406
Ig strand B 21987..21993 CDD:409406
Ig strand C 21999..22005 CDD:409406
FN3 22007..22514 CDD:442628
Ig strand D 22017..22022 CDD:409406
Ig strand E 22023..22029 CDD:409406
Ig strand F 22038..22046 CDD:409406
Ig strand G 22049..22059 CDD:409406
FN3 22357..22872 CDD:442628
Ig_Titin_like 22772..22851 CDD:409406
Ig strand A 22772..22776 CDD:409406
Ig strand B 22781..22787 CDD:409406
Ig strand C 22793..22799 CDD:409406
Ig strand D 22809..22814 CDD:409406
Ig strand E 22815..22821 CDD:409406
Ig strand F 22830..22838 CDD:409406
Ig strand G 22841..22851 CDD:409406
FN3 22855..22944 CDD:238020
FN3 22952..23043 CDD:238020
Ig_Titin_like 23062..23142 CDD:409406
Ig strand A 23062..23065 CDD:409406
Ig strand B 23070..23076 CDD:409406
Ig strand C 23082..23088 CDD:409406
Ig strand D 23100..23105 CDD:409406
Ig strand E 23106..23112 CDD:409406
FN3 23116..>23438 CDD:442628 22/87 (25%)
Ig strand F 23121..23129 CDD:409406
Ig strand G 23132..23142 CDD:409406
Ig 23457..23538 CDD:472250 19/93 (20%)
Ig strand B 23466..23470 CDD:409406 0/3 (0%)
Ig strand C 23479..23483 CDD:409406 0/3 (0%)
Ig strand E 23504..23508 CDD:409406 1/4 (25%)
Ig strand F 23518..23523 CDD:409406 1/4 (25%)
Ig strand G 23531..23534 CDD:409406 0/2 (0%)
FN3 <23584..>23830 CDD:442628 49/273 (18%)
Ig_Titin_like 23856..23935 CDD:409406 24/87 (28%)
Ig strand A 23856..23860 CDD:409406 1/3 (33%)
Ig strand B 23865..23871 CDD:409406 0/5 (0%)
FN3 <23875..24263 CDD:442628 85/441 (19%)
Ig strand C 23877..23883 CDD:409406 3/5 (60%)
Ig strand D 23893..23898 CDD:409406 2/8 (25%)
Ig strand E 23899..23905 CDD:409406 3/6 (50%)
Ig strand F 23914..23922 CDD:409406 3/7 (43%)
Ig strand G 23925..23935 CDD:409406 3/9 (33%)
Ig_Titin_like 24143..24224 CDD:409406 20/85 (24%)
Ig strand A 24143..24147 CDD:409406 0/3 (0%)
Ig strand B 24152..24158 CDD:409406 1/5 (20%)
Ig strand C 24164..24170 CDD:409406 3/5 (60%)
Ig strand D 24182..24187 CDD:409406 1/4 (25%)
Ig strand E 24188..24194 CDD:409406 1/8 (13%)
Ig strand F 24203..24211 CDD:409406 2/7 (29%)
Ig strand G 24214..24224 CDD:409406 4/9 (44%)
FN3 24228..24320 CDD:238020 28/112 (25%)
FN3 24328..24420 CDD:238020 14/91 (15%)
FN3 24427..24520 CDD:238020 14/92 (15%)
Ig_Titin_like 24539..24620 CDD:409406 14/89 (16%)
Ig strand A 24539..24543 CDD:409406 0/3 (0%)
Ig strand B 24548..24554 CDD:409406 2/13 (15%)
Ig strand C 24560..24566 CDD:409406 0/5 (0%)
Ig strand D 24578..24583 CDD:409406 1/4 (25%)
Ig strand E 24584..24590 CDD:409406 1/6 (17%)
Ig strand F 24599..24607 CDD:409406 0/7 (0%)
Ig strand G 24610..24620 CDD:409406 1/9 (11%)
FN3 24624..24716 CDD:238020 9/93 (10%)
FN3 24724..24813 CDD:238020 14/88 (16%)
FN3 24825..24913 CDD:238020 19/111 (17%)
Ig_Titin_like 24938..25017 CDD:409406 13/81 (16%)
Ig strand A 24938..24942 CDD:409406 1/3 (33%)
Ig strand B 24947..24953 CDD:409406 1/8 (13%)
Ig strand C 24959..24965 CDD:409406 1/5 (20%)
FN3 <24966..25396 CDD:442628 84/482 (17%)
Ig strand D 24975..24980 CDD:409406 0/4 (0%)
Ig strand E 24981..24987 CDD:409406 0/5 (0%)
Ig strand F 24996..25004 CDD:409406 1/7 (14%)
Ig strand G 25007..25017 CDD:409406 1/9 (11%)
FN3 25266..>25596 CDD:442628 62/341 (18%)
Ig 25621..25702 CDD:472250 18/80 (23%)
Ig strand B 25630..25634 CDD:409406 0/3 (0%)
Ig strand C 25643..25647 CDD:409406 0/3 (0%)
Ig strand E 25668..25672 CDD:409406 1/3 (33%)
FN3 <25682..25965 CDD:442628 39/292 (13%)
Ig strand F 25682..25687 CDD:409406 1/4 (25%)
Ig strand G 25695..25698 CDD:409406 0/2 (0%)
FN3 25806..25896 CDD:238020 11/89 (12%)
Ig_Titin_like 26021..26099 CDD:409406 18/93 (19%)
Ig strand A 26021..26024 CDD:409406 0/2 (0%)
Ig strand B 26029..26035 CDD:409406 0/5 (0%)
Ig strand C 26041..26047 CDD:409406 1/5 (20%)
Ig strand D 26057..26062 CDD:409406 0/4 (0%)
FN3 <26061..26447 CDD:442628 127/405 (31%)
Ig strand E 26063..26069 CDD:409406 0/5 (0%)
Ig strand F 26078..26086 CDD:409406 3/7 (43%)
Ig strand G 26089..26099 CDD:409406 2/9 (22%)
Ig_Titin_like 26307..26388 CDD:409406 24/81 (30%)
Ig strand A 26307..26311 CDD:409406 0/3 (0%)
Ig strand B 26316..26322 CDD:409406 1/5 (20%)
Ig strand C 26328..26334 CDD:409406 2/5 (40%)
Ig strand D 26346..26351 CDD:409406 0/4 (0%)
Ig strand E 26352..26358 CDD:409406 0/5 (0%)
Ig strand F 26367..26375 CDD:409406 3/7 (43%)
FN3 26376..>26685 CDD:442628 87/311 (28%)
Ig strand G 26378..26388 CDD:409406 3/9 (33%)
Ig 26703..26785 CDD:472250 23/82 (28%)
Ig strand B 26712..26716 CDD:409406 0/3 (0%)
Ig strand C 26725..26729 CDD:409406 0/3 (0%)
Ig strand E 26751..26755 CDD:409406 1/3 (33%)
Ig strand F 26765..26770 CDD:409406 3/4 (75%)
Ig strand G 26778..26781 CDD:409406 0/2 (0%)
FN3 <26831..27243 CDD:442628 112/426 (26%)
FN3 27283..27366 CDD:238020 34/84 (40%)
FN3 27343..27862 CDD:442628 139/525 (26%)
Ig_Titin_like 27390..27471 CDD:409406 20/80 (25%)
Ig strand A 27390..27394 CDD:409406 0/3 (0%)
Ig strand B 27399..27405 CDD:409406 2/5 (40%)
Ig strand C 27411..27417 CDD:409406 1/5 (20%)
Ig strand D 27429..27434 CDD:409406 0/4 (0%)
Ig strand E 27435..27441 CDD:409406 2/5 (40%)
Ig strand F 27450..27458 CDD:409406 3/7 (43%)
Ig strand G 27461..27471 CDD:409406 2/9 (22%)
Ig_Titin_like 27785..27866 CDD:409406 19/81 (23%)
Ig strand A 27785..27789 CDD:409406 1/3 (33%)
Ig strand B 27794..27800 CDD:409406 0/5 (0%)
Ig strand C 27806..27812 CDD:409406 2/5 (40%)
Ig strand D 27824..27829 CDD:409406 1/4 (25%)
Ig strand E 27830..27836 CDD:409406 2/5 (40%)
Ig strand F 27845..27853 CDD:409406 2/7 (29%)
Ig strand G 27856..27866 CDD:409406 1/9 (11%)
FN3 <27912..28297 CDD:442628 99/391 (25%)
Ig_Titin_like 28182..28261 CDD:409406 17/83 (20%)
Ig strand A 28182..28186 CDD:409406 2/6 (33%)
Ig strand B 28191..28197 CDD:409406 0/5 (0%)
Ig strand C 28203..28209 CDD:409406 2/5 (40%)
Ig strand D 28219..28224 CDD:409406 1/6 (17%)
Ig strand E 28225..28231 CDD:409406 1/5 (20%)
Ig strand F 28240..28248 CDD:409406 3/7 (43%)
Ig strand G 28251..28261 CDD:409406 0/9 (0%)
FN3 28265..28356 CDD:238020 35/102 (34%)
FN3 28362..28445 CDD:238020 26/88 (30%)
Ig_Titin_like 28472..28553 CDD:409406 19/81 (23%)
Ig strand A 28472..28476 CDD:409406 1/3 (33%)
Ig strand B 28481..28487 CDD:409406 2/5 (40%)
Ig strand C 28493..28499 CDD:409406 3/5 (60%)
Ig strand D 28511..28516 CDD:409406 1/4 (25%)
Ig strand E 28517..28523 CDD:409406 0/5 (0%)
FN3 28519..29233 CDD:442628 193/725 (27%)
Ig strand F 28532..28540 CDD:409406 3/7 (43%)
Ig strand G 28543..28553 CDD:409406 1/9 (11%)
Ig_Titin_like 28868..28949 CDD:409406 18/80 (23%)
Ig strand A 28868..28872 CDD:409406 0/3 (0%)
Ig strand B 28877..28883 CDD:409406 1/5 (20%)
Ig strand C 28889..28895 CDD:409406 2/5 (40%)
Ig strand D 28907..28912 CDD:409406 2/4 (50%)
Ig strand E 28913..28919 CDD:409406 0/5 (0%)
Ig strand F 28928..28936 CDD:409406 2/7 (29%)
Ig strand G 28939..28949 CDD:409406 1/9 (11%)
Ig_Titin_like 29268..29349 CDD:409406 24/80 (30%)
Ig strand A 29268..29271 CDD:409406 0/2 (0%)
Ig strand B 29276..29282 CDD:409406 1/5 (20%)
FN3 <29286..>29550 CDD:442628 86/271 (32%)
Ig strand C 29288..29294 CDD:409406 3/5 (60%)
Ig strand D 29306..29311 CDD:409406 1/4 (25%)
Ig strand E 29312..29318 CDD:409406 1/5 (20%)
Ig strand F 29327..29335 CDD:409406 3/7 (43%)
Ig strand G 29338..29349 CDD:409406 4/10 (40%)
Ig 29560..29627 CDD:472250 18/73 (25%)
Ig strand B 29568..29572 CDD:409406 0/3 (0%)
Ig strand C 29581..29585 CDD:409406 0/3 (0%)
Ig strand E 29606..29610 CDD:409406 2/10 (20%)
Ig strand F 29620..29625 CDD:409406 3/4 (75%)
FN3 29644..29736 CDD:238020 36/93 (39%)
FN3 <29707..>29929 CDD:442628 55/222 (25%)
Ig 29955..30035 CDD:472250 24/79 (30%)
Ig strand B 29963..29967 CDD:409406 0/3 (0%)
Ig strand C 29976..29980 CDD:409406 0/3 (0%)
Ig strand E 30001..30005 CDD:409406 1/3 (33%)
FN3 30013..30471 CDD:442628 120/461 (26%)
Ig strand F 30015..30020 CDD:409406 3/4 (75%)
Ig strand G 30028..30031 CDD:409406 0/2 (0%)
Ig_Titin_like 30353..30432 CDD:409406 16/80 (20%)
Ig strand A 30353..30357 CDD:409406 0/3 (0%)
Ig strand B 30362..30368 CDD:409406 0/5 (0%)
Ig strand C 30374..30380 CDD:409406 2/7 (29%)
Ig strand D 30390..30395 CDD:409406 0/4 (0%)
Ig strand E 30396..30402 CDD:409406 1/5 (20%)
Ig strand F 30411..30419 CDD:409406 4/7 (57%)
Ig strand G 30422..30432 CDD:409406 1/9 (11%)
FN3 30436..30520 CDD:238020 32/84 (38%)
FN3 30533..30616 CDD:238020 31/84 (37%)
Ig_Titin_like 30644..30724 CDD:409406 25/79 (32%)
Ig strand A 30644..30647 CDD:409406 1/2 (50%)
Ig strand B 30652..30658 CDD:409406 2/5 (40%)
Ig strand C 30664..30670 CDD:409406 3/5 (60%)
FN3 30678..31124 CDD:442628 124/449 (28%)
Ig strand D 30682..30687 CDD:409406 1/4 (25%)
Ig strand E 30688..30694 CDD:409406 0/5 (0%)
Ig strand F 30703..30711 CDD:409406 4/7 (57%)
Ig strand G 30714..30724 CDD:409406 1/9 (11%)
FN3 31128..31219 CDD:238020 32/91 (35%)
FN3 <31183..31560 CDD:442628 63/376 (17%)
Ig_Titin_like 31442..31521 CDD:409406 0/78 (0%)
Ig strand A 31442..31446 CDD:409406 0/3 (0%)
Ig strand B 31451..31457 CDD:409406 0/5 (0%)
Ig strand C 31463..31469 CDD:409406 0/5 (0%)
Ig strand D 31479..31484 CDD:409406 0/4 (0%)
Ig strand E 31485..31491 CDD:409406 0/5 (0%)
Ig strand F 31500..31508 CDD:409406 0/7 (0%)
Ig strand G 31511..31521 CDD:409406 0/9 (0%)
FN3 31525..31616 CDD:238020 2/90 (2%)
FN3 31622..31715 CDD:238020 22/92 (24%)
FN3 31756..>32115 CDD:442628 96/375 (26%)
Ig_Titin_like 32133..32211 CDD:409406 20/79 (25%)
Ig strand A 32133..32136 CDD:409406 0/2 (0%)
Ig strand B 32141..32147 CDD:409406 2/5 (40%)
Ig strand C 32153..32159 CDD:409406 2/5 (40%)
Ig strand D 32169..32174 CDD:409406 0/4 (0%)
Ig strand E 32175..32181 CDD:409406 0/5 (0%)
Ig strand F 32190..32198 CDD:409406 3/7 (43%)
Ig strand G 32201..32211 CDD:409406 3/9 (33%)
FN3 32218..32298 CDD:214495 33/79 (42%)
FN3 <32260..32620 CDD:442628 140/369 (38%)
Ig 32629..32704 CDD:472250 16/84 (19%)
Ig strand B 32633..32637 CDD:409406 0/3 (0%)
Ig strand C 32646..32650 CDD:409406 0/3 (0%)
Ig strand E 32671..32675 CDD:409406 0/3 (0%)
Ig strand F 32686..32691 CDD:409406 1/4 (25%)
Ig strand G 32699..32702 CDD:409406 0/2 (0%)
FN3 32710..32803 CDD:238020 36/92 (39%)
FN3 32812..32905 CDD:238020 35/95 (37%)
Ig 32915..33007 CDD:472250 32/91 (35%)
Ig strand B 32932..32936 CDD:409543 1/3 (33%)
Ig strand C 32945..32949 CDD:409543 0/3 (0%)
Ig strand E 32972..32976 CDD:409543 2/3 (67%)
Ig strand F 32986..32991 CDD:409543 1/4 (25%)
Ig strand G 32999..33002 CDD:409543 1/2 (50%)
Ig_Titin_like 33024..33105 CDD:409406 28/80 (35%)
Ig strand A 33024..33027 CDD:409406 0/2 (0%)
Ig strand B 33032..33038 CDD:409406 4/5 (80%)
Ig strand C 33044..33050 CDD:409406 3/5 (60%)
Ig strand D 33062..33067 CDD:409406 2/4 (50%)
Ig strand E 33068..33074 CDD:409406 1/5 (20%)
Ig strand F 33084..33092 CDD:409406 3/7 (43%)
Ig strand G 33095..33105 CDD:409406 2/9 (22%)
FN3 33109..33200 CDD:238020 34/90 (38%)
STKc_Titin 33237..33513 CDD:271006 117/283 (41%)
IgI_Titin_M1-like 33556..33645 CDD:409521 12/88 (14%)
Ig strand A 33557..33560 CDD:409521 1/2 (50%)
Ig strand A' 33563..33566 CDD:409521 0/2 (0%)
Ig strand B 33570..33579 CDD:409521 0/8 (0%)
Ig strand C 33585..33591 CDD:409521 0/5 (0%)
Ig strand C' 33593..33596 CDD:409521 1/2 (50%)
Ig strand D 33602..33607 CDD:409521 2/4 (50%)
Ig strand E 33611..33617 CDD:409521 0/5 (0%)
Ig strand F 33624..33632 CDD:409521 0/7 (0%)
Ig strand G 33635..33644 CDD:409521 0/8 (0%)
I-set 33676..33768 CDD:400151 24/100 (24%)
Ig strand B 33693..33697 CDD:409543 2/3 (67%)
Ig strand C 33706..33710 CDD:409543 1/3 (33%)
Ig strand E 33734..33738 CDD:409543 1/3 (33%)
Ig strand F 33748..33753 CDD:409543 2/4 (50%)
Ig strand G 33761..33764 CDD:409543 1/2 (50%)
I-set 33781..33871 CDD:400151 29/111 (26%)
Ig strand B 33798..33802 CDD:409353 1/3 (33%)
Ig strand C 33811..33815 CDD:409353 0/3 (0%)
Ig strand E 33837..33841 CDD:409353 0/3 (0%)
Ig strand F 33851..33856 CDD:409353 1/4 (25%)
Ig strand G 33864..33867 CDD:409353 1/2 (50%)
Ig 34361..34450 CDD:472250 26/88 (30%)
Ig strand B 34378..34382 CDD:409543 0/3 (0%)
Ig strand C 34391..34395 CDD:409543 1/3 (33%)
Ig strand E 34416..34420 CDD:409543 1/3 (33%)
Ig strand F 34430..34435 CDD:409543 2/4 (50%)
Ig strand G 34443..34446 CDD:409543 0/2 (0%)
PTZ00121 <34455..35189 CDD:173412 27/187 (14%)
IgI_Titin_like 34545..34636 CDD:143224 21/91 (23%)
Ig strand A 34547..34554 CDD:143224 0/6 (0%)
Ig strand A' 34555..34560 CDD:143224 1/4 (25%)
Ig strand B 34565..34573 CDD:143224 2/7 (29%)
Ig strand C 34577..34583 CDD:143224 1/5 (20%)
Ig strand C' 34585..34587 CDD:143224 1/1 (100%)
Ig strand D 34593..34599 CDD:143224 2/5 (40%)
Ig strand E 34602..34608 CDD:143224 1/5 (20%)
Ig strand F 34617..34624 CDD:143224 1/6 (17%)
Ig strand G 34627..34636 CDD:143224 1/8 (13%)
Ig 34705..34794 CDD:472250
Ig strand B 34720..34724 CDD:409353
Ig strand C 34735..34739 CDD:409353
Ig strand E 34761..34765 CDD:409353
Ig strand F 34775..34780 CDD:409353
I-set 34891..34980 CDD:400151
Ig strand B 34908..34912 CDD:409353
Ig strand C 34921..34925 CDD:409353
Ig strand E 34946..34950 CDD:409353
Ig strand F 34960..34965 CDD:409353
Ig strand G 34973..34976 CDD:409353
I-set 35173..35262 CDD:400151
Ig strand B 35190..35194 CDD:409543
Ig strand C 35203..35207 CDD:409543
Ig strand E 35228..35232 CDD:409543
Ig strand F 35242..35247 CDD:409543
Ig strand G 35255..35258 CDD:409543
I-set 35368..35460 CDD:400151
Ig strand B 35385..35389 CDD:409406
Ig strand C 35398..35402 CDD:409406
Ig strand E 35426..35430 CDD:409406
Ig strand F 35440..35445 CDD:409406
Ig strand G 35453..35456 CDD:409406
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.