DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bt and twk-40

DIOPT Version :9

Sequence 1:NP_001162825.1 Gene:bt / 43814 FlyBaseID:FBgn0005666 Length:8933 Species:Drosophila melanogaster
Sequence 2:NP_001255206.1 Gene:twk-40 / 189006 WormBaseID:WBGene00006691 Length:436 Species:Caenorhabditis elegans


Alignment Length:59 Identity:15/59 - (25%)
Similarity:28/59 - (47%) Gaps:6/59 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1587 YVSDSSGMDFRAMLKKRRYQKWDKDEQDPNWGDLKETEKPLPALKKVERKVESFLSPLI 1645
            |.....||..|.|.::..:::    |||.|..|:  |.:|:...|...|.:.:.:|.::
 Worm    10 YTPGRVGMFTRPMHQRHYHRR----EQDQNENDI--TSRPMATWKTYARIILAHVSLIV 62

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
btNP_001162825.1 I-set 9..101 CDD:254352
Ig 26..100 CDD:143165
I-set 119..210 CDD:254352
Ig 136..209 CDD:143165
I-set 228..320 CDD:254352
IGc2 242..312 CDD:197706
I-set 335..425 CDD:254352
Ig 350..423 CDD:143165
Ig 436..530 CDD:299845
I-set 438..532 CDD:254352
I-set 545..636 CDD:254352
Ig 560..633 CDD:143165
Ig 657..731 CDD:143165
I-set 746..835 CDD:254352
Ig 1496..1586 CDD:299845