DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bt and unc-89

DIOPT Version :10

Sequence 1:NP_001162825.1 Gene:bt / 43814 FlyBaseID:FBgn0005666 Length:8933 Species:Drosophila melanogaster
Sequence 2:NP_001020985.1 Gene:unc-89 / 171990 WormBaseID:WBGene00006820 Length:8081 Species:Caenorhabditis elegans


Alignment Length:9961 Identity:1968/9961 - (19%)
Similarity:3164/9961 - (31%) Gaps:3739/9961 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LLSSPKPDIEWFR---SDNKVVEDVRTKFKIQPVGENKYTVVLELDDVVET----------DAGL 83
            :|...:|.:..||   .|.:..|.|| |..::.:.|.:.....|.|.:..|          |..:
 Worm   414 VLQPQEPGLPSFRIKPKDFETSEYVR-KAWLRDIAEEQEKYAAERDAISMTATSEMTASSVDFDM 477

  Fly    84 YKVKAKNKSGEVSASINLNFTPADE---PKEKQIDG---FAPTFA-------------------- 122
            .....:::..|.|.|...:..|..|   |..|::..   .:||.:                    
 Worm   478 NASDQQSEFSEWSGSRKSSLFPGPEEGGPPRKKVKSPPVISPTGSSTSIYSGGSSSIDWTTTGTT 542

  Fly   123 ---KKPAIRQEEDGKRLLFE-----C-RVNADPIPAIIWFHNGAAVKESERHKITVDKDVHSYFA 178
               :...:.:.:.|.|.|.|     | :|...|:|.|.|:.:...:.|.|||....|:|  .:||
 Worm   543 LEMQGTRVTRTQYGFRTLQESSAKMCLKVTGYPLPDITWYKDDVQLHEDERHTFYSDED--GFFA 605

  Fly   179 -TLEILNVTVEDAGKYKVNAKNELGESNATI---SLNFDSDEAPVPESAEGIKPTFTERPVIRQS 239
             |::.:.||  |.|:|...|.||.|:::.:.   .|..:.:.||         |.|..:...::.
 Worm   606 MTIDPVQVT--DTGRYTCMATNEYGQASTSAFFRVLKVEKEAAP---------PAFVTKLRDKEC 659

  Fly   240 EDGGNVTFECRCVGDPTPTVTWSHGETELNESNRYKMSLTMDQKLYHIACLEISSVVSSDQGEYR 304
            ::|..:.|||...|.|.|.:.|...:..|..|:.:::     |.....|.|||......|.|.|.
 Worm   660 KEGDVIDFECEVEGWPEPELVWLVDDQPLRPSHDFRL-----QYDGQTAKLEIRDAQPDDTGVYT 719

  Fly   305 AQAKNKHGSGVATINLNFESGSKKIPDGKSPRFPKKPTIR----QEEDLLIMECVLEAHPVPDIV 365
            .:.:|:.||..:...|..::...|  :..:|.|  :.||.    .|.:.:..:.|:...|.|:|:
 Worm   720 VKIQNEFGSIESKAELFVQADPDK--NHVAPEF--QATIEYVECDEGEEVRFKSVITGDPNPEII 780

  Fly   366 WYCSEKEICNNQRTKMTRKAITKDSYILTLEIQNPTKEDGGNYRCNAINMYGESNANIALNFQGA 430
            |:.:.|.:..:::.|.    |::|. |..|.|::.|:...|...|...|..|.::.:..|..:..
 Worm   781 WFINGKPLSESEKVKF----ISEDG-ICILTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVP 840

  Fly   431 SDANGFAPSFIEKP---RIIPNESGTLITMKCKCKAKPEPTVTW-YRGQDLVEKSKKIKINTTVI 491
            .     ||....||   :.:..:|  .:..:......||||:|: ..|::|....:.::|   |.
 Worm   841 P-----APPTFNKPLEDKTVQEKS--TVVFEVDVSGWPEPTLTFTLCGKELKNGEEGVEI---VG 895

  Fly   492 AEDTYELTLEIKDPGATDGGTYRCNVKNEYGESNANLNLNIEAEPEPEGEGPTFIEKPRIVSENN 556
            .:..|.:::........||... ...:||:|.:.:...|.:|.|.|.....|||::.....:...
 Worm   896 HDGFYRISIPNTSMDKHDGEIV-AKAQNEHGTAESRARLTVEQEEEESRSAPTFLKDIEDQTVKT 959

  Fly   557 GKLVIMECKVKADPKPDVIWFRNGEVIKE-SNKIKTFIEQRGDQYYIKLELLDPQLEDSGLYKCN 620
            |:..:.|..|:.:|.|:|.||.||..:.: |..:|  ||.....:.:.::    ..:.:|...|.
 Worm   960 GEFAVFETTVRGNPNPEVTWFINGHKMDQGSPGVK--IEAHNHDHKLTID----SAQYAGTVLCR 1018

  Fly   621 IKNTLGELNANLTLNIEIVPVIKDKPKIIKIIKKR------TVVIECTVASKFEPKCTWYKETST 679
            .:|.:|.......|.:......|..||.::|:..:      |||.|..|..:.:|..|||.:...
 Worm  1019 AENAVGRFETKARLVVLAPEKQKKPPKFVEILVDKTETVDNTVVFEVRVEGEPKPTVTWYLKGEE 1083

  Fly   680 VKESKRHVYQVEQTKEGEFAVKLEINDVEESDKGAYKLVASNEKGEAVSQIVNLVDIPEEERKPC 744
            :|:|.|     .:.:|.:.::|:.|.:::..|.|..:.||:|.:|...::....|     ::||.
 Worm  1084 LKQSDR-----VEIREFDGSIKISIKNIKIEDAGEIRAVATNSEGSDETKAKLTV-----QKKPF 1138

  Fly   745 KPEISRK---LADQKVAES-----------KTFELLVSLSQTDRKCKVEWYKGSTVIRETKDITT 795
            .||...:   |..:|.:|:           .|:|..|:    .||.:    .|....|.|:| .:
 Worm  1139 APEFDLRPVSLTVEKGSEAVFSAHAFGIPLPTYEWSVN----GRKVR----DGQEGARVTRD-ES 1194

  Fly   796 TFDGTTARLTFSSARTEHTSNY---KVIVTNEVGKDESSCKITVEKVAKKKEEKPKEKE---KTK 854
            |.||.:. ||..:|......|:   .|:..|.:|.:|:..::|:|   .|||....||:   .::
 Worm  1195 TVDGASI-LTIDTATYYSEVNHLTISVVAENTLGAEETGAQLTIE---PKKESVVVEKQDLSSSE 1255

  Fly   855 NEKEVEQK----------------------------------------EMEEDKNES------GQ 873
            .:||:.|:                                        |.:|.::||      |.
 Worm  1256 VQKEIAQQVKEASPEATTTITMETSLTSTKTTTMSTTEVTSTVGGVTVETKESESESATTVIGGG 1320

  Fly   874 SVAQTEGRINIEQIS------------EGDPKEELTVKE-----EILD------KRDTQEVKESS 915
            |...|||.|::.:|.            ||.||..::..|     |::|      |..:.:.||.|
 Worm  1321 SGGVTEGSISVSKIEVVSKTDSQTDVREGTPKRRVSFAEEELPKEVIDSDRKKKKSPSPDKKEKS 1385

  Fly   916 VELQD--------SAGHEVPEPKKAT--SDSKLDQS----NQKNLDKKHKTDQSESKTNKNVSLA 966
            .|..:        ..|.||..||:.:  |.:|.::|    ..|:..||.|:..|.:|..|:.|  
 Worm  1386 PEKTEEKPASPTKKTGEEVKSPKEKSPASPTKKEKSPAAEEVKSPTKKEKSPSSPTKKEKSPS-- 1448

  Fly   967 EPIKSNKQESEEQQATEQIGLKKVDRKASIVSVKEEISSDVRRKST------IKAKEEITVDDKK 1025
            .|.|....|.:|:...     |...:|.......|::.|.|:::.:      ::...|.|::  |
 Worm  1449 SPTKKTGDEVKEKSPP-----KSPTKKEKSPEKPEDVKSPVKKEKSPDATNIVEVSSETTIE--K 1506

  Fly  1026 ASSRRSSLAVEESNTESRRSSIIDKKPLEQVDNK---PIDANKNPQ-PLKEEIPRLKPAEKRRTS 1086
            ..:..::....||  |..|:|:..:|..|:||.|   |...:|:|: .:.|||.  .|.:|.::.
 Worm  1507 TETTMTTEMTHES--EESRTSVKKEKTPEKVDEKPKSPTKKDKSPEKSITEEIK--SPVKKEKSP 1567

  Fly  1087 KVIEEPKPDEGLPKLRKASIAQVKEEAKPAAPKLKA--KAKAKPKYEELPE---IPDYERPQLEK 1146
            :.:|| ||.....|        .|...|||:|..|:  :.|:..|.|:.||   :.:.:.|:.:.
 Worm  1568 EKVEE-KPASPTKK--------EKSPEKPASPTKKSENEVKSPTKKEKSPEKSVVEELKSPKEKS 1623

  Fly  1147 YEKSDFTP-----------SDFARDLEIPNKMEK-PIIDSGKKEPAVLAQKNGIP-KKTDIIEQY 1198
            .||:|..|           .....|::.|.|.|| |  :..:::|....:|...| ||||     
 Worm  1624 PEKADDKPKSPTKKEKSPEKSATEDVKSPTKKEKSP--EKVEEKPTSPTKKESSPTKKTD----- 1681

  Fly  1199 ADEPKGLKVGKGKLPDEGDGRDGAVLKPVIIEPEKEILDLGNKKNNQHADKPTVLDIIKQRRRSS 1263
             ||.|. ...|.|.|...:.:..:..|.. ..|||.:::.......:..:|      .:::.:|.
 Worm  1682 -DEVKS-PTKKEKSPQTVEEKPASPTKKE-KSPEKSVVEEVKSPKEKSPEK------AEEKPKSP 1737

  Fly  1264 IRNLMTKEPIQNESFLGVVLKPVIKD-TREQAAPQQAIQLTKANAT-------EQFSPTKAVKAQ 1320
            .:    ||....:|....|..|..|: :.|::|.::....||..::       |..||||..|:.
 Worm  1738 TK----KEKSPEKSAAEEVKSPTKKEKSPEKSAEEKPKSPTKKESSPVKMADDEVKSPTKKEKSP 1798

  Fly  1321 VADLKKPETLATLEDNYERPVLEKYDPFSIDKTKSEKSTPSIITPDIRGPEVKLPVQETKEEKQK 1385
            ....:||.:....|...|:...|:..    ..||.||| ||..|.. .|.|.|....|..|||.|
 Worm  1799 EKVEEKPASPTKKEKTPEKSAAEELK----SPTKKEKS-PSSPTKK-TGDESKEKSPEKPEEKPK 1857

  Fly  1386 VPKMQPPAPGDPPKIEVIREKRPSLAPE---PPSRR----------------------------- 1418
            .|..:...||.|       :|:.|.:||   ||:.:                             
 Worm  1858 SPTPKKSPPGSP-------KKKKSKSPEAEKPPAPKLTRDLKLQTVNKTDLAHFEVVVEHATECK 1915

  Fly  1419 ----------------------------------------------GS---------LIPPADTG 1428
                                                          ||         |..|.:| 
 Worm  1916 WFLDGKEITTAQGVTVSKDDQFEFRCSIDTTMFGSGTVSVVASNAAGSVETKTELKVLETPKET- 1979

  Fly  1429 RRPSLIINDEKKLRPGEV-------MDT--------------RLLRPGEVG---EGQRRRPSIDV 1469
            ::|..    ..|||..||       ||.              .||..|:.|   :.:..:.|:.:
 Worm  1980 KKPEF----TDKLRDMEVTKGDTVQMDVIALHSPLYKWYQNGNLLEDGKNGVTIKNEENKSSLII 2040

  Fly  1470 RRPSVQDLEDL------------------INKPSTPLRDVGDGGPPSIVDVQESYSVVEDSTAYL 1516
              |:.||...:                  :|.|||         .|.:||..:|.::.|..||..
 Worm  2041 --PNAQDSGKITVEASNEVGSSESSAQLTVNPPST---------TPIVVDGPKSVTIKETETAEF 2094

  Fly  1517 TVGVEGSPAPTFKFYKGVSE-ILEGGRFKFLTDGQTNTITLCMRKCKPNDESKYKIVVSNIHGED 1580
            ...:.|.||||.|:  .::| |:|          ::.|||..      ..|..|.:.:||...|.
 Worm  2095 KATISGFPAPTVKW--TINEKIVE----------ESRTITTI------KTEDVYTLKISNAKIEQ 2141

  Fly  1581 SAEMQLYVSDSSGMDFRAMLKKRRYQKWDKDEQDPNWGDLKETEKPLPALKKVERKVES--FLSP 1643
            :..:::...:|:|                   ||....||           |||..|::  |.|.
 Worm  2142 TGTVKVTAQNSAG-------------------QDSKQADL-----------KVEPNVKAPKFKSQ 2176

  Fly  1644 LIDQFAKEGKDKKVVFEARFSKPNCKPKWLFRKDEVFTGSKFKFKQEND-TYQLIITTPKVEDTG 1707
            |.|:.|.||:..:...|.....|..:..||.....:......:.....| ||.:.|...|.|.:|
 Worm  2177 LTDKVADEGEPLRWNLELDGPSPGTEVSWLLNGQPLTKSDTVQVVDHGDGTYHVTIAEAKPEMSG 2241

  Fly  1708 KYTIE----IGGVSSTAFLNVEEADPTYTFTKPLKKKLEGFTQ----HETTLECSVSSS------ 1758
            ..|.:    .|...::|.:.|...:          ||.| |.|    ||||||.||..|      
 Worm  2242 TLTAKAKNAAGECETSAKVTVNGGN----------KKPE-FVQAPQNHETTLEESVKFSAIVTGK 2295

  Fly  1759 -MANVHWFKNNTKL-ESDDPRYLISKDINGNLKLIIKDSVLDDAGLYRCQLDKQPDKTE--CNLK 1819
             |.||.|:.||.|| :|::.:.....: .|...:.|:..:::..|..|.:.:....|.:  ..||
 Worm  2296 PMPNVTWYLNNKKLIQSEEVKVKYVHE-TGKTSIRIQKPLMEHNGTIRVEAENVSGKVQATAQLK 2359

  Fly  1820 V---TEYPYKFVKVLKSQQCIEKDTVTLACEIDD-AMGEVQWLRNGEEIKPDKRIQIV-KDGRKR 1879
            |   ||.| ||...:..:|..|.:.|.....::. ....|.|..|||.:.....|.:. ||| :.
 Worm  2360 VDKKTEVP-KFTTNMDDRQVKEGEDVKFTANVEGYPEPSVAWTLNGEPVSKHPNITVTDKDG-EH 2422

  Fly  1880 KLVIKDCKVTDAGQFKC-TTNADTTESEII------INYQNRFNKKLKDTEAVEREKLILDIELQ 1937
            .:.|.......||:..| .||...::...:      :.....|.|.|:|....|.|..::|.:|.
 Worm  2423 TIEISAVTPEQAGELSCEATNPVGSKKRDVQLAVKKVGDAPTFAKNLEDRLITEGELTLMDAKLN 2487

  Fly  1938 --DQTAPCDWKFNGEPIVPSESIEIKNMGGGKHQLIFSSLDMSNEGEIT----CESGQLSSKCKL 1996
              .......|..:|..|......:|.....|..:|......:.::|.||    .|.|.......|
 Worm  2488 IVKPKPKITWLKDGVEITSDGHYKIVEEEDGSLKLSILQTKLEDKGRITIKAESEFGVAECSASL 2552

  Fly  1997 SIRKGESRPNIDCPDKFSGPISAPVLLEVPFKVSGTKQTPVEAKLFKDGKPLP------------ 2049
            .:.||.             |::.|........::.|:...:|.||...|.|.|            
 Worm  2553 GVVKGR-------------PMAKPAFQSDIAPINLTEGDTLECKLLITGDPTPFVKWYIGTQLVC 2604

  Fly  2050 -VKDVEVAVTDDKVTFKIKKPSRDLSGPYQIKISNGQGEDTKD--VQIICQDVPQPPQDVDITDV 2111
             .:|.|::..:...|.||...:.|::|..:....|..||.:.:  ::::   .|.|.:       
 Worm  2605 ATEDTEISNANGVYTMKIHGVTADMTGKIKCVAYNKAGEVSTEGPLKVV---APIPVE------- 2659

  Fly  2112 YQTS-CVVSFNPPSDDGGTPITKYVIERQDLSKKHGWESVAEVLPSEPCLKKIDDLIPKKQYRFR 2175
            ::|| |                       |.:.:.|                 |.|        :
 Worm  2660 FETSLC-----------------------DATCREG-----------------DTL--------K 2676

  Fly  2176 IRAVNAIGQSDPATFKNTILAKDPWDEPGKPKAVDLTDWDKDHADLKWEAPETDGGDPITAYIVE 2240
            :||| .:|:.:|.                                :.|                 
 Worm  2677 LRAV-LLGEPEPV--------------------------------VSW----------------- 2691

  Fly  2241 YKEKFSNDWVSGKEVDGDAR----------TATVDGLKEGQQYEFRVRAVNRAGP---------- 2285
                    :|:||:::....          |.|:..:......:....|:|..|.          
 Worm  2692 --------YVNGKKLEESQNIKIHSEKGTYTVTIKDITCDYSGQVVCEAINEYGKATSEATLLVL 2748

  Fly  2286 --GEPSDKTKSIIAKCRFVKPFIVGEGLKNVTVKKGQTIRFDIKYDGEPEPAATW-VKGTDNLKF 2347
              |||.|              |:  |.|.||..:.|..:...:.:.|:|:|:.|| :...:.|..
 Worm  2749 PRGEPPD--------------FL--EWLSNVRARTGTKVVHKVVFTGDPKPSLTWYINNKEILNS 2797

  Fly  2348 DNQRICLDQLERNSSITIKKSVRKD--TGKYKLVLSNSSGTI-----------------ESEAQV 2393
            |...|..|  ::.|::|| .|...|  .|:......|.:|.:                 |||||.
 Worm  2798 DLYTIVTD--DKTSTLTI-NSFNPDVHVGEIICKAENDAGEVSCTANMITYTSDMFSESESEAQA 2859

  Fly  2394 -------VVLDRPLPPGGPFEPEEIRASHIKMKWKR---------------PDDDGGC------- 2429
                   :..|..|.......|..:.|.....|.|.               ||..|.|       
 Worm  2860 EEFVGDDLTEDESLREEMHRTPTPVMAPKFITKIKDTKAKKGHSAVFECVVPDTKGVCCKWLKDG 2924

  Fly  2430 -EISGYALERMDEETGRWIPAGEVGPNETSFDFKGLTPNKKYKFRVKAINKEGESEPLETFDAIV 2493
             ||...|..|:...||   |.|.: ..|...|  .:||....|:.....|..|:    :|.:|.:
 Worm  2925 KEIELIARIRVQTRTG---PEGHI-TQELVLD--NVTPEDAGKYTCIVENTAGK----DTCEATL 2979

  Fly  2494 ARNPYDPPSPPSQPVIDDYDNKSVLLKWKRPPSDGGRPITHYIVEIKDKFAPSWSEVAKTDDPNP 2558
            .             ||:..:.||.    |:.|        .:||.::||       ..||     
 Worm  2980 T-------------VIESLEKKSE----KKAP--------EFIVALQDK-------TTKT----- 3007

  Fly  2559 ECNVEGLKEKMVYQFRVRAVNKAGPSEPSQPTDNHLCKHKNLKPQIDRSTFKRVTIKSGRTHKWS 2623
                   .||:|.:                      ||                           
 Worm  3008 -------SEKVVLE----------------------CK--------------------------- 3016

  Fly  2624 VDVLGEPIPELHWSWRDDIPLTNGDRIKIENVDYHTDFSITNVLRKDSGFYTLKAENRNGIDRET 2688
              |:|||.|::  ||..|......:.|.:|:|:.....:||:......|.||..|||..|..:..
 Worm  3017 --VIGEPKPKV--SWLHDNKTITQESITVESVEGVERVTITSSELSHQGKYTCIAENTEGTSKTE 3077

  Fly  2689 VELVVLGKPSSPKGPLAVSDVTASGCKLQWKKPEDDGGVPIKEYVVEKMDTATGKWVRVGRSPGE 2753
            ..|.|.|     :.|:...:       ||.|:                                 
 Worm  3078 AFLTVQG-----EAPVFTKE-------LQNKE--------------------------------- 3097

  Fly  2754 KEPPSFDVTGLSLGSEYMFRVSAVNEEGESEPLTTLVGVVAKDPFDEPNKPGTPEVTDYDNQSIS 2818
                      ||:|.:.:...|.   :|..:|......      |.|..|..| ::|.....:| 
 Worm  3098 ----------LSIGEKLVLSCSV---KGSPQPHVDFYS------FSETTKVET-KITSSSRIAI- 3141

  Fly  2819 LKWAAPNNDGGAPIQKYIIEKKNKNKTEWEKALEIPGDQLEATVAGLQEYGEYQFRVIAVNKAGL 2883
                                :.::..|.|...:.      :.|...:..|     :.||.|..|.
 Worm  3142 --------------------EHDQTNTHWRMVIS------QITKEDIVSY-----KAIATNSIGT 3175

  Fly  2884 SPPSDASVPQIVKYKKLKPRIDRSNLKPLLIRAGKPIRYDVNVRGEPAPVITWYQNDKELKPEEL 2948
            :    .|..:|.  .|::..:....||...::..:.|:.:|.|.|. ||.:.|:::|   ||...
 Worm  3176 A----TSTSKIT--TKVEAPVFEQGLKKTSVKEKEEIKMEVKVGGS-APDVEWFKDD---KPVSE 3230

  Fly  2949 PSSSEIKNIPYNTKISII--ETVRKHTGIYKIIAVNEHGQDEATVEVNILAPPSKPRGPLDVKDV 3011
            ..:.|:|..|.....:::  :......|.|...|.|..|..|::.|..:.....|   |..|:::
 Worm  3231 DGNHEMKKNPETGVFTLVVKQAATTDAGKYTAKASNPAGTAESSAEAEVTQSLEK---PTFVREL 3292

  Fly  3012 TKDSCKLKWKKPEDDGGKPISAYQVEKFDKKQGRWVPLGRTSANDT---EFDVKGLQEGHEYQFR 3073
            .....|:                                    |:|   ...|||:.:       
 Worm  3293 VTTEVKI------------------------------------NETATLSVTVKGVPD------- 3314

  Fly  3074 VKAINEEGESDPLDSDDS-IIAKNPYDAASKPGTPNIVDYNEHMVKLKWEAPRSDGGAPISGYII 3137
             .::....:..|:.:|.| :|||             :.....:.:.:| :|...|.|        
 Worm  3315 -PSVEWLKDGQPVQTDSSHVIAK-------------VEGSGSYSITIK-DARLEDSG-------- 3356

  Fly  3138 EKKDKFSPIWDEILSTNTSVPEATVEGLVEGNIYQFRVRAVNKAGFSDPSDATEPHLAKPRNLKP 3202
                                              ::..||.|.||    ...||.:.|..:||.|
 Worm  3357 ----------------------------------KYACRATNPAG----EAKTEANFAVVKNLVP 3383

  Fly  3203 YINRDKMKPIKVRAGQPVKFDVDVKGEPAPSLTWFLKETELTSTGQVRLENIDYNTKLTLLDTDR 3267
            ....:|:.|::|:..:.....|.|.|.|.||:.||                              
 Worm  3384 PEFVEKLSPLEVKEKESTTLSVKVVGTPEPSVEWF------------------------------ 3418

  Fly  3268 KQSGQYKLRAENINGVDEAVVEVIILDKPSKPEGPIEVSDIHKEGCKLKWRKPKDDGGIPITGYV 3332
                                          |.:.||.:.::|                      |
 Worm  3419 ------------------------------KDDTPISIDNVH----------------------V 3431

  Fly  3333 IEKMDTATGKWVPAGSV---DPEKYDIEIKGLDPNHRYQFRVKAVNEEGESEPLETESAITAKNP 3394
            |:| .||.|.:    |:   |..:.|:.|          :..:|.||.||        |:|..| 
 Worm  3432 IQK-QTAVGSF----SLTINDARQGDVGI----------YSCRARNEAGE--------ALTTAN- 3472

  Fly  3395 FDVSAPPGLPELEDWDEHHVKLKWEPPIRDGGSPITNYIIEVMDKDSGEFVKAVETDSPVCKGVV 3459
            |.:                        |||                                   
 Worm  3473 FGI------------------------IRD----------------------------------- 3478

  Fly  3460 KKLEEGQQYKFRVRAVNKAGPSDPSEQTNWHVAKPRFLKPHIDRVNLKPVIVKTGLSISLDINIR 3524
                                 |.|.|.|.                .|:|:.|:...::.|.:.:.
 Worm  3479 ---------------------SIPPEFTQ----------------KLRPLEVREQETLDLKVTVI 3506

  Fly  3525 GEPAPKVEWFFNNSSVTSDEHSVKIDNVDYNTK--------FFVMRAQRSQSGKYIIKATNEVGE 3581
            |.|.|.||||       .|:..:.|||.....|        ..:.:|:....|.|..|||||.||
 Worm  3507 GTPVPNVEWF-------KDDKPINIDNSHIFAKDEGSGHHTLTIKQARGEDVGVYTCKATNEAGE 3564

  Fly  3582 DEAELEVTVLGKPGKPKGPLQVNDITKHSCKLKWEKPDDDGGSPIDYYEIEKLDPHTGQWLPCGK 3646
            .:....:.|   ..:.:.||.|..:          ||          ||:|              
 Worm  3565 AKTTANMAV---QEEIEAPLFVQGL----------KP----------YEVE-------------- 3592

  Fly  3647 STEPEAKVIGLHEGKAYKFRVRAVNKEGESEDLETEKPIIAKNPYDEPDRPGKPEP-TNWDKDFV 3710
                        :||..:..||.                           .||||| ..|.||.|
 Worm  3593 ------------QGKPAELVVRV---------------------------EGKPEPEVKWFKDGV 3618

  Fly  3711 DLAWDPPKNDGGAPIQKYVIQMRDKSGRAWVDSATVPGDKCNGTVTGVEEGHEYEFRIVAVNKAG 3775
            .:|.|          .::||:.:.::|     |.|:.....|....|       ::...|.||||
 Worm  3619 PIAID----------NQHVIEKKGENG-----SHTLVIKDTNNADFG-------KYTCQATNKAG 3661

  Fly  3776 ----------PSDPSDVSKSVIAKPRFLKPHIDRKNLQKKIMRSGQMLHIDALIKAEPPAKVTWT 3830
                      |....:...:...||.|::|      |::.....|..:.::..:..|...::.:.
 Worm  3662 KDETVGELKIPKYSFEKQTAEEVKPLFIEP------LKETFAVEGDTVVLECKVNKESHPQIKFF 3720

  Fly  3831 YNKTEIKTSDHIKIE-NEDYKTTFIMPKVKRADRGIYIVTAKNDSGSDTVEVELEVLCKPSKPKG 3894
            .|...::...|:::| .||......:...|:.|.|.|...|.|.:|......:|::         
 Worm  3721 KNDQPVEIGQHMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKI--------- 3776

  Fly  3895 PLAVSNVTAETLHLKWEKPEDDGGDPIEQYLVERMDTETGRWVPVLTTKTPEADVTGLTEGKEYL 3959
                      ....|.|:...|....:|         |.|::..|..|.:.:.| ||        
 Worm  3777 ----------QFAAKVEEHVTDESGQLE---------EIGQFETVGDTASSKTD-TG-------- 3813

  Fly  3960 FRVKAVNSEGESEPLVTDIPTKAKNPFDAADTPGKPQIVDWSGNHCDLKWRAPEDDGGASITGYI 4024
                                            .|.|:.|:                         
 Worm  3814 --------------------------------RGAPEFVE------------------------- 3821

  Fly  4025 VERKDPNTGKWQKALETSTPDCKARVNDLIAGNKYQFRIMAVNKAGKSKPSEPSDQMTAKDRFAP 4089
            :.|....|.|.|..|:     ||.:                         .||.           
 Worm  3822 LLRSCTVTEKQQAILK-----CKVK-------------------------GEPR----------- 3845

  Fly  4090 PKIDRTNIKDITIKAGQHIRFDIKVSGEPPATKVWLHNKARLENDDSNYNIDMESYRTKLTVPIS 4154
            |||..|       |.|:.:....:|..|              ..||....:..::.         
 Worm  3846 PKIKWT-------KEGKEVEMSARVRAE--------------HKDDGTLTLTFDNV--------- 3880

  Fly  4155 KRFHSGKYTLKAENESGRDEASFEVIVLDKPGPPEGPLRVTDVHKEGCKLKWNAPLDDGGLPIDH 4219
            .:..:|:|..:||||.|             ....|||:.||   .||      ||..||..|   
 Worm  3881 TQADAGEYRCEAENEYG-------------SAWTEGPIIVT---LEG------APKIDGEAP--- 3920

  Fly  4220 YIIEKMDVESGRWLPSGRFKESFAELNNLEPSHEYKFRVLAVNTEGESEPLTGEQSVIAKNPFDE 4284
                                                                         .|.:
 Worm  3921 -------------------------------------------------------------DFLQ 3924

  Fly  4285 PGKPGTPEAVDWDKDHVDLVWRPPINDGGSPITGYVVEKREKGTDKWIKGTEITIPCLGEECKAT 4349
            |.||..                                              :|:          
 Worm  3925 PVKPAV----------------------------------------------VTV---------- 3933

  Fly  4350 VPTLNENCEYEFRVKAINAAGPGEPSDASKPIITKPRKLAPKIDRKNIRTYNFKSGEPIFLDINI 4414
                                                                   ||...|:..|
 Worm  3934 -------------------------------------------------------GETAVLEGKI 3943

  Fly  4415 SGEPAPDVTWNQNNKSVQTTSFSHIENLPYNTKYIN-NNPERKDTGLYKISAHNFYGQDQVEFQI 4478
            ||:|.|.|.|.:|.:.::.:....||||...|:.:. .|.:..|...|:..|.|.:|  .|...:
 Worm  3944 SGKPKPSVKWYKNGEELKPSDRVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFG--DVWSDV 4006

  Fly  4479 NIITK------PG--KPEGPLEVSEVH--KDGCKLKWKKPKDDGGEPVESYLVEKFDPDTGIWLP 4533
            .:..|      ||  |....::|.|..  |..||:...||.           |:.|         
 Worm  4007 TLTVKEPAQVAPGFFKELSAIQVKETETAKFECKVSGTKPD-----------VKWF--------- 4051

  Fly  4534 VGRSDGPEYNVDGLVPGHDYKFRVKAVNKEGESEPLETLGSIIAKDPFSVPTKPGVPEPTDWTAN 4598
               .||.....|            |.|:.|...:..:.|   :.:|           ..||    
 Worm  4052 ---KDGTPLKED------------KRVHFESTDDGTQRL---VIED-----------SKTD---- 4083

  Fly  4599 KVELAWPEPASDGGSPIQGYIVEVKDKYSPLWEKALETNSPTPTATVQGLIEGNEYQFRVVALNK 4663
                       |.|:    |.:||.:       .|...||..|...|                  
 Worm  4084 -----------DQGN----YRIEVSN-------DAGVANSKVPLTVV------------------ 4108

  Fly  4664 GGLSEPSDPSKIFTAKPRYLAPKIDRRNLRNITLSSGTALKLDANITGEPAPKVEWKLSNYHL-- 4726
                 ||:..||             ::.|.::.::.||.:.|...:.|:| ..|:|......:  
 Worm  4109 -----PSETLKI-------------KKGLTDVNVTQGTKILLSVEVEGKP-KTVKWYKGTETVTS 4154

  Fly  4727 -QSGKNVTIETPDYYTKLVIRPTQRSDSGEYLVTATNTSGKDSVLVNVVIT---DKPSPPNGPLQ 4787
             |:.|.|.:...:|  ||.|...:.||:|.|.|..:..|........|.:|   :|.|.|:    
 Worm  4155 SQTTKIVQVTESEY--KLEIESAEMSDTGAYRVVLSTDSFSVESSATVTVTKAAEKISLPS---- 4213

  Fly  4788 ISDVHKEGCHLKWKRPSDDGGTPIEYFQIDKLEPETGCWIPSCRSTEPQVDVTGLSPGNEYKFRV 4852
                        :|:...|...|                                          
 Worm  4214 ------------FKKGLADQSVP------------------------------------------ 4224

  Fly  4853 SAVNAEGESQPLVGDESIVARNPFDEPGKPENLKATDWDKDHVDLAWTPPLIDGGSPISCYIIEK 4917
                   :..|||.:..|        .|||:::|   |.|:             |..|       
 Worm  4225 -------KGTPLVLEVEI--------EGKPKDVK---WYKN-------------GDEI------- 4251

  Fly  4918 QDKYGKWERALDVPADQCKATIPDLVEGQTYKFRVSAVNAAGTGEPSDSTPPIIAKAR----NKP 4978
              |.||.|   |:...:.:.||||..|....::.|:|.|.||         .|.:||:    .||
 Worm  4252 --KDGKVE---DLGNGKYRLTIPDFQEKDVGEYSVTAANEAG---------EIESKAKVNVSAKP 4302

  Fly  4979 PIIDRSSLVEVRIKAGQSFTFDCKVSGEPAPQTKWLLKKKEV---YSKDNVKVTNVDYNTKLKVN 5040
            .|:  |.||...:|.|::.||:.||.| |....||....||:   .:|||               
 Worm  4303 EIV--SGLVPTTVKQGETATFNVKVKG-PVKGVKWYKNGKEIPDAKTKDN--------------- 4349

  Fly  5041 SATRSDSGIYTVFAENANGEDSADVKVTVIDKPAPPNGPLKVDEINSESCTLHWNPPDDDGGQPI 5105
                 ..|.|::...||..||:||.||.|.:...        |..:|.:.|:..   .|||...:
 Worm  4350 -----GDGSYSLEIPNAQVEDAADYKVVVSNDAG--------DADSSAALTVKL---ADDGKDKV 4398

  Fly  5106 DNYVVEKLDETTGRWIPAGETDGPVTALKVGGLTPGHKYKFRVRAKNRQGTSEPLTTAQAIIAKN 5170
            ...:|..|..||   :..|||                 ..|.|:.|.        ...|....||
 Worm  4399 KPEIVSGLIPTT---VKQGET-----------------ATFNVKVKG--------PVKQVKWYKN 4435

  Fly  5171 PFDVPTKPGTPTIKDFDKEFVDLEWTRPEADGGSPITGYVVEKRDKFSPDWEKCAEISDDITNAH 5235
            ..::|....    ||             ..||     .|.:|                  |.||.
 Worm  4436 GKEIPNAKA----KD-------------NGDG-----SYSLE------------------IPNAQ 4460

  Fly  5236 VPDLIEGLKYEFRVRAVNKAGPGSPSDATETH---VARPKNTPPKIDRNFMSDIKIKAGNVFEFD 5297
            :.|..     :::|...|.||....|.|....   :|..|.         :.|.::..|......
 Worm  4461 LDDTA-----DYKVVVSNDAGDADSSAALTVKLPGIAIVKG---------LEDAEVPKGKKAVLQ 4511

  Fly  5298 VPVTGEPLPSKDWTHEGNMIINTDRVKI-SNFDDRTKIRILDAKRSDTGVYTLTARNINGTDRHN 5361
            |....:|...| |...|..|..:|:.:. |:.|::.::.|.||...|...|              
 Worm  4512 VETNKKPKEIK-WYKNGKEITPSDKAQPGSDGDNKPQLVIPDAGDDDAAEY-------------- 4561

  Fly  5362 VKVTILDAPSVPEGPLRNGDVSKNSIVLRWRPPKDDGGSEITHYVVEKMDNEAMRWVPVGDCTDT 5426
             ||.:.|         .:|:.:.:|..|..:.|..:      ..:::.::::.   |.:|.....
 Worm  4562 -KVVLTD---------EDGNTADSSCALTVKLPAKE------PKIIKGLEDQV---VSIGSPIKL 4607

  Fly  5427 EIRADNLIENHDYSFRVRAVNKQGQSQPLTTSQPITAKDPYSHPDKPGQPQATDWGKHFVDLEWS 5491
            ||                                          :..|.|:...|.|:..:|.  
 Worm  4608 EI------------------------------------------ETSGSPKTVKWYKNGKELP-- 4628

  Fly  5492 TPKRDGGAPISSYIIEKRPKFGQWERAAVVLGDNCKAHVPELTNG-----GEYEFRVIAVNRGGP 5551
                  ||...:..|:|             :.||  .:|.|:.:.     |:|:..|  .|..|.
 Worm  4629 ------GAAAKTIKIQK-------------IDDN--KYVLEIPSSVVEDTGDYKVEV--ANEAGS 4670

  Fly  5552 SDPSDPSSTIICKPRFLAPFFDKSLLNDITVHAGKRLGWTLPIEASPRPLITWLYNGKEIGSNSR 5616
            :: |....|:..|..||.|..|:|:..      |:...:::.....|| ::.|..||:||..|||
 Worm  4671 AN-SSGKITVEPKITFLKPLKDQSITE------GENAEFSVETNTKPR-IVKWYKNGQEIKPNSR 4727

  Fly  5617 GESGLF----QNELTFEIV--SSLRSDEGRYTLILKNEHGSFDASAHATVLDRPSPPKGPLDITK 5675
                 |    :.:..:::|  :::|.|...|.::|:|..|..::||..||      .|....:.|
 Worm  4728 -----FIIEQKTDTKYQLVIKNAVRDDADTYKIVLENTAGEAESSAQLTV------KKAKAGLCK 4781

  Fly  5676 ITRDGCHLTWNVPDDDGGSPILHYIIEKMDLSRSTWSDAGMSTHIVHDVTRLVHRKEYLFRVKAV 5740
            |.:                                    |:...:|....::|      |.||  
 Worm  4782 IVK------------------------------------GLEDQVVAKGAKMV------FEVK-- 4802

  Fly  5741 NAIGESDPLEAVNTIIAKNEFDEPDAPGKPIITDWDRDHIDLQWAVPKSDGGAPISEYIIQKKEK 5805
                                     ..|:|....|.||      |...|.|...|.|.|..    
 Worm  4803 -------------------------IQGEPEDVRWLRD------ANVISAGANAIIEKIDD---- 4832

  Fly  5806 GSPYWTNVR-HVPSNKNTTTIPELTEGQEYEFRVIAVNQAGQSEPSEPSDMIMAKPRYLPPKIIT 5869
                 |..| .:||       .:|.:..||...||  |::|::: |:....:..|     |:|:.
 Worm  4833 -----TTYRLIIPS-------ADLKDAGEYTVEVI--NESGKAK-SDAKGEVDEK-----PEIVR 4877

  Fly  5870 PLNEVRIKCG--LIFHTDIHFIGEPAPEATWTLNSNPLLSNDRSTITSIGHHSVVHTVN-CQRSD 5931
            .|..:.|..|  .:|..:   :..|..:..|..|...:..|.......||.......:| .|..|
 Worm  4878 GLENIEIPEGDDDVFKVE---VSAPVRQVKWYKNDQEIKPNSHLEAKKIGPKKYELAINRAQLDD 4939

  Fly  5932 SGIYHLLLRNSSGIDEGSFELVVLDRPGPPEGPMEYEEITANSVTISWKPPKDNGGSEISSYVIE 5996
            ...|.::|.|::|..:.|..|.|:                        ||       .:...|..
 Worm  4940 GADYKVVLSNAAGDCDSSAALTVV------------------------KP-------NVLKIVDG 4973

  Fly  5997 KRDLTHGGGWVPAVNYVSAKYNHAVVPRLLEGTMYELRVMAENLQGRSDPLTSDQPVVAK----S 6057
            .:|:.                       :.|....||:|..|.:           |.|.|    .
 Worm  4974 LKDVD-----------------------VEEPQPVELKVKVEGI-----------PKVIKWYKNG 5004

  Fly  6058 QYTVPGAPG-----KPELTDSDKNHITIKWKQPISNGGS--PIIGYDIERRDVNTGRWIKINGQP 6115
            |...|.|.|     |||   |.:..:||...:. |:||:  .::|.|  :.:|.:|..:.:.   
 Worm  5005 QELKPDADGFKFEEKPE---SGEFSLTIPSSKK-SDGGAYRVVLGND--KGEVYSGSVVHVK--- 5060

  Fly  6116 VPTAEYQDDRVTSNHQYQYRISAVNAAGNGKTSEPSAIFN-ARPLREKPRFYFDGLIGKRIKVRA 6179
                                        :.|:|||::..| ..||::             .:|..
 Worm  5061 ----------------------------SAKSSEPTSGANFLSPLKD-------------TEVEE 5084

  Fly  6180 GEPVNLNIPISGAPTPTIEWKRGDLKLEEGKRISYETNSERT-LFRIDDSNRRDSGKYTVTAANE 6243
            |:.:.|...|:|.|.|.:.|::..:.|::..||:.....:.| ..||..:.:.|.|:|.|||.||
 Worm  5085 GDMLTLQCTIAGEPFPEVIWEKDGVVLQKDDRITMRVALDGTATLRIRSAKKSDIGQYRVTAKNE 5149

  Fly  6244 FGKDTADIEVIVV---DKPSPPEG--PLSYTETAP-------------DHISLHWY--------- 6281
            .|..|:|.:|.|.   ::||.|:.  ||......|             ...:|.|:         
 Worm  5150 AGSATSDCKVTVTEQGEQPSKPKFVIPLKTGAALPGDKKEFNVKVRGLPKPTLQWFLNGIPIKFD 5214

  Fly  6282 -----SPKDDGGSDITGYIIEFTEFGVDDWKPVPGTCPNTNFTVKNLVEGKKYVFRIRAENIYGA 6341
                 ....||     .|.:...:...:|:..:.....|.|.|.:.:.|     |:..|.:..|:
 Worm  5215 DRITLDDMADG-----NYCLTIRDVREEDFGTLKCIAKNENGTDETVCE-----FQQGAGHDDGS 5269

  Fly  6342 SEALEGKPVLAKSPFD---PPGAP--------SQPTISAYTPNSANLEWHPPDDCGGKPITGYIV 6395
            .:.|...|......:|   |.|.|        :.||        |.:||..    .||.|     
 Worm  5270 RDDLRYPPRFNVPLWDRRIPVGDPMFIECHVDANPT--------AEVEWFK----DGKKI----- 5317

  Fly  6396 ERRERGGEWIKCNNYPTPNTSYT-VSNLRDGA------RYE------FRVLAVNEAGPGHPSKPS 6447
                             .:|::| :.|..|||      .:|      :..:||||.|........
 Worm  5318 -----------------EHTAHTEIRNTVDGACRIKIIPFEESDIGVYMCVAVNELGQAETQATY 5365

  Fly  6448 DPMTAEH---QRYRPDPPE--PPKPDRITRNG--VTLSWR----------------PPRTDGKSR 6489
            .....||   ::.|...|:  ||..|:....|  :.||.:                |.|.|.::.
 Worm  5366 QVEILEHVEEEKRREYAPKINPPLEDKTVNGGQPIRLSCKVDAIPRASVVWYKDGLPLRADSRTS 5430

  Fly  6490 IKGYYVEMRPKNGKDWKTVNDIPINSTVYTVPSLKEGEEYSFRVVAENEVGRSDPS------KPS 6548
            |:  |.|    :|.....:||    ||        |.:..::|.||.|..|..:.|      .|.
 Worm  5431 IQ--YEE----DGTATLAIND----ST--------EEDIGAYRCVATNAHGTINTSCSVNVKVPK 5477

  Fly  6549 QPITIEEQPNKPCMELGKVRDIVCRAGDDFSIHVPYLAFPKPNAFWYSNDNMLDDNNR-VHKHLT 6612
            |  .::::..:|....|.| |:....||.|::.......|.|...||.|..:|.:..| |.:...
 Worm  5478 Q--EVKKEGEEPFFTKGLV-DLWADRGDSFTLKCAVTGDPFPEIKWYRNGQLLRNGPRTVIETSP 5539

  Fly  6613 DDAASVVVKNSKRADSGQYRLQLKNTSG--FDTATINVRV-LDRPSPPTRLRADEFSGDSLTLYW 6674
            |.:.|:.|..|..:|.|.||.:.:|..|  ...||.:|:: |.:...|   :.||         .
 Worm  5540 DGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHVQMALGKTEKP---KMDE---------G 5592

  Fly  6675 NPPNDDGGSAIQNYIIEKKEARSSTWSKVSSFCTVPFVRIRNLVLNKEYDFRVIAENKYGQSDPA 6739
            .||         .:|:|..:...|..:.:...|.|                              
 Worm  5593 KPP---------KFILELSDMSVSLGNVIDLECKV------------------------------ 5618

  Fly  6740 NTSEPILARHPFDIPNTPGIPHGIDSTEDSITIAWTKPKHDGGSPITGYIIEKRLLSDDKWTKAV 6804
                             .|:|:.        ::.|:|   ||| |:   |.:.|....::.:|.|
 Worm  5619 -----------------TGLPNP--------SVKWSK---DGG-PL---IEDSRFEWSNEASKGV 5651

  Fly  6805 HALCPDLSCKIPNLIENAEYEFRVAAVNAAGQSAYSG--------SSDLIFCRRPPHAPKITSDL 6861
            :.|      :|.|...:.|..:|..|.|..|.:....        .|.::...:|   |:.|  |
 Worm  5652 YQL------RIKNATVHDEGTYRCVATNENGSATTKSFVRMDDGLGSGVVTASQP---PRFT--L 5705

  Fly  6862 SIRDMTVIAGDEFRITVPYHASPRPTASWSLNGLEVIPGERIKFD-SNDYASMYYNKSAKRDETG 6925
            .:.|:....|...::.....|||.|...|..:|..|.|.:||:.. |.|..:.....|...|:.|
 Worm  5706 KMGDVRTTEGQPLKLECKVDASPLPEMVWYKDGAIVTPSDRIQISLSPDGVATLLIPSCVYDDDG 5770

  Fly  6926 SYTITLTNNKGSDTASCHVTVVDRPLPPQGPLNAYDITPDTCTLAWKTPLDDGGSPITNYVVEKL 6990
            .|.:..||..|        |..|:               .|.|:. |.|.|.|..          
 Worm  5771 IYRVIATNPSG--------TAQDK---------------GTATVK-KLPRDSGAR---------- 5801

  Fly  6991 DNSGSWVKISSFVRNTHYDVMGLEPHYKYNFRVRAENQYGLSDPLDIIEPIVAKHQFTVPDEPGQ 7055
                         |:...||.                                       |....
 Worm  5802 -------------RSADRDVF---------------------------------------DANKA 5814

  Fly  7056 PKVIDWDSGNVTLIWTRPLSDGGSRIQGYQIEYRDILNDSSWNAYDYIIKDTKYQLYNLINGSEY 7120
            ||:::            ||.:                                            
 Worm  5815 PKLME------------PLEN-------------------------------------------- 5823

  Fly  7121 EFRIKAKNAAGLSKPSSPSLRFKLKGKFTVPSPPGAPQVTRVGKNYVDLKWEKPLRDGGSRITGY 7185
             .||..|.:            |:|:.||:     |.|:.|        :||.|    .|.|:..|
 Worm  5824 -IRIPEKQS------------FRLRCKFS-----GDPKPT--------IKWFK----DGERVFPY 5858

  Fly  7186 ----IIE--------------RRDIGGAVWVKCNDYNVLDTEYTVMNLIEMGDYEFRVFAVNSAG 7232
                :||              |:|.||...|..|.|....|...| |:|. ||.:.|  .::|:.
 Worm  5859 GRLQLIESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDV-NVIR-GDRKPR--DIDSSI 5919

  Fly  7233 RSEPSLCTMPIKVCEVLGGKKPDWITRLQDKVAPFGKDYTLQCAASGKPSPTARWLRNGKE---- 7293
            |.                ||.|.:.|.|..:.|..|...|.:|...|.|.|:.:||::|.|    
 Worm  5920 RE----------------GKAPGFTTPLTIRRAKPGDSVTFECLPFGNPFPSIKWLKDGLELFSD 5968

  Fly  7294 --IQMNGGRMTCDSKDGVFRLHISNVQTGDDGDYTCEAMNSLGFVNTSGYL------KIGSPPI- 7349
              |:|..      :.||..||.:|:|....:|.:.|.|.|..|..:|...|      .|||.|: 
 Worm  5969 EKIKMEA------AADGTQRLILSDVTFLSEGYFRCVATNEHGTASTKAELVIEGDRTIGSRPLP 6027

  Fly  7350 -INRCPSELK-----------LPEGDNSKIKIFYSG-DQPLTVILKKNNEVICDSNDDTHVKVNI 7401
             :|..|.|.|           :.||:..::.:..:| ..|.....|...|::.|..|...|   |
 Worm  6028 EVNGEPEECKPRIRRGLYNMSIHEGNVVEMIVCATGIPTPTVKWYKDGQEIVGDGPDGKRV---I 6089

  Fly  7402 FDDYVAIY---IRNIVKSDGGPYQIEFTNESGSATGEFYVHIT------------GMPSAPTGPM 7451
            |.|...|:   |.|....|.|.|.:|.||:.|||..|..::|.            |||..|    
 Worm  6090 FTDERGIHHLVIVNASPDDEGEYSLEATNKLGSAKTEGSLNIIRPRHIADADERGGMPFPP---- 6150

  Fly  7452 GISYINKNSCMLNWRPPSYDGGLKVSHYVIE-------RKDV------------SSPHWITVSST 7497
            |.....||..:.|..|..:| .|.|.|...|       :|.|            .|...|.:.:|
 Worm  6151 GFVRQLKNKHVFNHMPTIFD-CLVVGHPAPEVEWFHNGKKIVPGGRIKIQSCGGGSHALIILDTT 6214

  Fly  7498 CKDTAFNVQGLIENQEYIFRVMAVNENG-------MGPPLEGLNPIRAKDPIDP----------- 7544
            .:|..          ||:  ..|.|.:|       :...:..|:.|:....||.           
 Worm  6215 LEDAG----------EYV--ATAKNSHGSASSSAVLDVTVPFLDSIKFNGEIDVTPYLTEEYGFK 6267

  Fly  7545 -------PSPPG-SPQITEIGGDFVHLEWEKPESDGGAHIQ-GYWIDKREVGSNTWQ----RVNA 7596
                   |:||. .|.|.|:.|.::.|.|...:.....:.| .|.|:.||:....|.    .:..
 Worm  6268 KLNTASLPTPPDRGPFIKEVTGHYLTLSWIPTKRAPPRYPQVTYVIEIRELPEKQWSLLEYNIPE 6332

  Fly  7597 TICAANQINCINLIEGRQYEFRIFAQNVAGLSTESSAS------------------QAVKIIDPQ 7643
            .:|...     ||..|:.|:||:.|:|:.|:|..|.||                  :.:.::||.
 Worm  6333 PVCKVR-----NLELGKSYQFRVRAENIYGISDPSPASPPSRLMAPPQPVFDRRTNKVIPLLDPY 6392

  Fly  7644 AA-----------------SPPLIVKPLRDANCIQNHNAQFTCTINGVPKPTISW-YKG----AR 7686
            |.                 ||.::.|    ..|.:|........::|.|.|.|.| ::|    ..
 Worm  6393 AEKALDMRYSEQYACAPWFSPGVVEK----RYCAENDTLTIVLNVSGFPDPDIKWKFRGWDIDTS 6453

  Fly  7687 EISNGARYHMYSEGDNHFLNINDVFGEDADEYVCRAVNKAGAKSTRATLAIMTAPKLNVPPRFRD 7751
            ..::..:.:.|. |....|.|.....|:..:|.|.|.|..|.......:.:.|.|.. :.|....
 Worm  6454 SPTSKCKVYTYG-GSETTLAITGFSKENVGQYQCFAKNDYGDAQQNIMVDLATRPNF-IQPLVNK 6516

  Fly  7752 TAYFDKGENVVIKIPFTGFPKPRIHWVRDGENI-ESGGHYTVEVKERHAVLIIRDGSHLDSGPYR 7815
            |  |...:.:.:.:...|.|.|.:.|:::...| ||.....|:.......|||.|....|||.|.
 Worm  6517 T--FSSAQPMRMDVRVDGEPFPELKWMKEWRPIVESSRIKFVQDGPYLCSLIINDPMWRDSGIYS 6579

  Fly  7816 ITAENELGSDTAIIQVQISDRPDPPRFPLIESIGTESLSLSWKAPVWDGCSDITNYYVERREHPL 7880
            ..|.|:.|..|                                                      
 Worm  6580 CVAVNDAGQAT------------------------------------------------------ 6590

  Fly  7881 SSWIRVGNTRFTSMAVSGLTPGKEYDFRIFADNVYGRSDASDTSTLIKTKESVKKKPIERKWEID 7945
                       ||..|:                |....|.:|.. |.:.:.:::.:.:...:||.
 Worm  6591 -----------TSCTVT----------------VEAEGDYNDVE-LPRRRVTIESRRVRELYEIS 6627

  Fly  7946 ANGRKLRGKADGPVKDYDSYVFDIYSKFVPQPVEISQQSVYDRYDILEEIGTGAFGVVHRCRERS 8010
            ....||                                              .|.|...|.:|::
 Worm  6628 EKDEKL----------------------------------------------AAEGAPFRVKEKA 6646

  Fly  8011 TGNIFAAKFIPVSHSVEKDLIRREIDIMNQLHHQKLINLHDAFEDDDEMILILEFLSGGELFERI 8075
            ||..|.|:..|:.     |.:.|.:||.|.|.|..::.:|....  ||.:.::.|.:.....:.:
 Worm  6647 TGREFLAQLRPID-----DALMRHVDIHNSLDHPGIVQMHRVLR--DEKLALVVFDNANSTIDGL 6704

  Fly  8076 TA---EGYVMTEAEVIN-------YMRQICEGIRHMHEQNIIHLDIKPENIMCQTRSSTNVKLID 8130
            ::   .|..:.|.:.:|       ::||:...::|||:..|.|||::||.|:.|   ...:||.|
 Worm  6705 SSLAHPGVEIAEPKGVNRETCVRVFVRQLLLALKHMHDLRIAHLDLRPETILLQ---DDKLKLAD 6766

  Fly  8131 FGLATRLDPNEVVKITTGTAEFAAPEIVNREPVGFYTDMWATGVLSYVLLSGLSPFAGDNDVQTL 8195
            ||.|.||....:.....|:.||.:||||...|:...||||:||||:||||:|||||.||||.:||
 Worm  6767 FGQARRLLRGLITGEIKGSPEFVSPEIVRSYPLTLATDMWSTGVLTYVLLTGLSPFHGDNDNETL 6831

  Fly  8196 KNVKACDWDFD-VESFKYISEEAKDFIRKLLVRNKEKRMTAHECLLHPWLTGDHSAMKQEINRD- 8258
            .||.:|.:|.. :.:|.|   :|.||::|||......|:|..|.|.|||: .|.....:.::.| 
 Worm  6832 ANVDSCQFDSSPLGNFSY---DAGDFVKKLLTEIPVSRLTVDEALDHPWI-NDEKLKTEPLSADT 6892

  Fly  8259 -RYLAYREK-LRRKY--------EDFERFL-------------LPIGR--LSEYSSLR------- 8291
             |...|:.| |.|:.        :..|..|             .|.||  ...|..||       
 Worm  6893 LREFKYQHKWLERRVFVQQTPSEQILEAILGPATAQAQQNAPVAPEGRRPAEIYDYLRIQPKKPP 6957

  Fly  8292 ---KLLMEKYKIH-------------DAVFDR-----------------------RQAA------ 8311
               :.:.:..|.|             || |||                       .|||      
 Worm  6958 PTVEYVPQPRKEHPPFIDEFGQLIDGDA-FDRPEGTGFEGPHRQPPQIPPQPQRPNQAAHDSRRH 7021

  Fly  8312 ------------------------PRFV----IRPSS----QFCYE--GQSVKF--YCRCIA--- 8337
                                    ||::    .||||    .|..:  |..|.|  |.|.:|   
 Worm  7022 EQQPQHQGQPQRIPVDQYGRPLVDPRYLNDPSHRPSSLDDAPFYVDKYGNPVHFDKYGRPMAPQN 7086

  Fly  8338 --------------------------IATPTLT-----WSHNNIELRQSVKFMKRYVGDDYYFII 8371
                                      :|||.|.     .....|.:|. ::..:|.:.::   |.
 Worm  7087 LEKRKLIPQDKGETPSHSKKEKTQHPVATPILASPGGDQQQQKIPMRM-IRGERREIEEE---IA 7147

  Fly  8372 NRVKLDDRGEYIIRAENHYGSREEVVFLNVQPLPKE------QPRYRTESTPVRRREPLPYTFWQ 8430
            ||:..|...|..|.     ||   :..|....:||:      :|...|.:..|..||.:|.   .
 Worm  7148 NRILSDISEEGSIA-----GS---LASLEDFEIPKDFQVEASEPSTPTLTPEVTIRETIPK---P 7201

  Fly  8431 EESETAPSFT------FLLRPRVMQARDTCKLLCCLSGKPVPNVRWYKD---------------- 8473
            ..|.|:|..:      .||.|..:...|:     .|:|.|..:.:..:|                
 Worm  7202 TPSPTSPQKSPVPQPQGLLIPAKVTYSDS-----ILAGLPAADKKVLEDAENDPSIPVGAPLFLE 7261

  Fly  8474 GRELSKYEYAMTHSDGV--VTMEIIDCKPS-DSGKYSCKATN----------------------- 8512
            |...|......|.:.|:  ||...|:..|: .|.:.|...|.                       
 Worm  7262 GLHGSDLTIDTTSASGLIKVTSPAINLSPNPKSPRRSTPGTKSPVVLSPRQEHSMEVLIATKRGK 7326

  Fly  8513 ---------CHGTDETDCVVIVEGEWVTPEQAQLAHNF--------------------------- 8541
                     ....|:.|..:....:.|.|:.....::|                           
 Worm  7327 PGFLPPGELAEDIDDEDAFMDDRKKQVKPKDHDGENDFKDEKERLEKDKNRRTVNLDDLDKYRPS 7391

  Fly  8542 -LYSGD---------------------------------------RKYIEQ-------------- 8552
             .|..|                                       |.|.|:              
 Worm  7392 AFYKDDSDFGHPGYDIDATPWDSHYQIGPDTYLMAARGAAFNSRVRNYREELFGMGAPTVKQGFL 7456

  Fly  8553 PIKPAPLPIVTSRQYTSSSVQNTSEPQGDKVNVSNSNSSGISNKKKYASNSL--QAPGSPSRSR- 8614
            .::...:.:...|:||               ::....:.|:..|....|.:|  :||.:.:..| 
 Worm  7457 GVRNRDITVRERRRYT---------------DILRETTQGLEPKSHEQSTALLQKAPSATAIERI 7506

  Fly  8615 SATKELILP-----PDDSLMCKPEFTKPLHDLTIHDGEQLILTCYVKGDPEPQISWSKNGKSLSS 8674
            .|..|.:.|     .||.... |.||..|.|:.:...:..|..|.|...|.|:::|...||.|.|
 Worm  7507 KADIEKVTPCATKKNDDGTFA-PIFTARLRDVYLRKNQPAIFECAVSASPAPKVTWDFQGKILES 7570

  Fly  8675 SDILDLRYKNGIATLTINEVFPEDEGVITCTATNSVGAVETKCKLTIQPLDKNINKRKVNAGDN- 8738
            :|.:.:...|.:|.|.:|...|.|.|...|||.|..|..::.|:|..........:.:.....: 
 Worm  7571 NDRVTIEQDNNVARLILNHAAPYDLGEYVCTAINEYGTDKSSCRLISGETPSRPGRPEAELSSDT 7635

  Fly  8739 -------APKIVSHLESRFVRDGDAVNLACRIIGAQHFDVVWLHNNKEI-KPSKDFQYTNEANIY 8795
                   ||:..::||      |....|..|:.|.......|:..:::| ..|...::.:...||
 Worm  7636 EIFIQWEAPEGPTYLE------GITYRLEYRVAGPNDHGDPWITVSEKIDDESVIVKHLSPLGIY 7694

  Fly  8796 RLQIAEIFPEDGGTYTCEAFNDIG---ESFSTCTINVTVPGDETKQPSFVKFPTSVSVL------ 8851
            :.::.             |.|..|   .|.|:..:.....|....|...:|....::|:      
 Worm  7695 QFRVT-------------AQNGFGLGLPSLSSRIVQTHGKGAPKLQIDVLKSEIRLNVVSMPQKS 7746

  Fly  8852 --EGEGTTFECEIDSE 8865
              :..|.:.|.|.|||
 Worm  7747 TNQLGGISEESEEDSE 7762

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btNP_001162825.1 Ig 9..101 CDD:472250 17/81 (21%)
Ig strand B 26..30 CDD:409353
Ig strand C 39..43 CDD:409353 0/3 (0%)
Ig strand E 69..73 CDD:409353 0/3 (0%)
Ig strand F 83..88 CDD:409353 0/4 (0%)
Ig strand G 96..99 CDD:409353 1/2 (50%)
I-set 119..210 CDD:400151 30/123 (24%)
Ig strand B 136..140 CDD:409353 2/8 (25%)
Ig strand C 149..153 CDD:409353 1/3 (33%)
Ig strand E 174..182 CDD:409353 3/8 (38%)
Ig strand F 192..197 CDD:409353 1/4 (25%)
Ig strand G 205..208 CDD:409353 0/2 (0%)
Ig 228..320 CDD:472250 23/91 (25%)
Ig strand B 245..249 CDD:409353 1/3 (33%)
Ig strand C 258..262 CDD:409353 0/3 (0%)
Ig strand E 286..292 CDD:409353 2/5 (40%)
Ig strand F 302..307 CDD:409353 1/4 (25%)
Ig strand G 317..320 CDD:409353 0/2 (0%)
Ig 335..425 CDD:472250 22/93 (24%)
Ig strand B 350..354 CDD:409353 0/3 (0%)
Ig strand C 363..367 CDD:409353 1/3 (33%)
Ig strand E 393..397 CDD:409353 1/3 (33%)
Ig strand F 407..412 CDD:409353 1/4 (25%)
Ig strand G 420..423 CDD:409353 0/2 (0%)
Ig 438..532 CDD:472250 20/97 (21%)
Ig strand B 455..459 CDD:409353 0/3 (0%)
Ig strand C 468..472 CDD:409353 2/4 (50%)
Ig strand E 498..502 CDD:409353 0/3 (0%)
Ig strand F 512..517 CDD:409353 0/4 (0%)
Ig strand G 525..528 CDD:409353 0/2 (0%)
Ig 545..636 CDD:472250 20/91 (22%)
Ig strand B 560..564 CDD:409353 0/3 (0%)
Ig strand C 573..577 CDD:409353 1/3 (33%)
Ig strand E 599..606 CDD:409353 0/6 (0%)
Ig strand F 616..621 CDD:409353 1/4 (25%)
Ig strand G 629..632 CDD:409353 0/2 (0%)
Ig 656..726 CDD:472250 21/69 (30%)
Ig strand B 657..661 CDD:409353 2/3 (67%)
Ig strand C 670..674 CDD:409353 1/3 (33%)
Ig strand E 700..704 CDD:409353 1/3 (33%)
Ig strand F 714..719 CDD:409353 0/4 (0%)
Ig strand G 728..731 CDD:409353 0/2 (0%)
Ig 746..835 CDD:472250 25/105 (24%)
Ig strand C 777..781 CDD:409353 0/3 (0%)
Ig strand E 802..806 CDD:409353 1/3 (33%)
Ig strand F 816..821 CDD:409353 2/7 (29%)
Ig 1508..1588 CDD:472250 20/80 (25%)
Ig strand B 1514..1518 CDD:409353 1/3 (33%)
Ig strand C 1527..1531 CDD:409353 2/3 (67%)
Ig strand E 1554..1558 CDD:409353 2/3 (67%)
Ig strand F 1568..1573 CDD:409353 1/4 (25%)
Ig strand G 1581..1584 CDD:409353 0/2 (0%)
Ig 1639..1724 CDD:472250 21/91 (23%)
IG_like 1750..1821 CDD:214653 23/83 (28%)
Ig strand B 1750..1753 CDD:409353 2/2 (100%)
Ig strand C 1761..1765 CDD:409353 2/3 (67%)
Ig strand E 1788..1792 CDD:409353 0/3 (0%)
Ig strand F 1802..1806 CDD:409353 1/3 (33%)
Ig 1826..1909 CDD:472250 20/91 (22%)
Ig strand B 1842..1846 CDD:409353 1/3 (33%)
Ig strand C 1854..1858 CDD:409353 1/3 (33%)
Ig strand E 1879..1883 CDD:409353 0/3 (0%)
Ig 1914..1998 CDD:472250 20/89 (22%)
Ig 2020..2095 CDD:472250 18/89 (20%)
Ig strand B 2021..2025 CDD:409353 0/3 (0%)
Ig strand C 2038..2042 CDD:409353 2/3 (67%)
Ig strand E 2062..2066 CDD:409353 1/3 (33%)
Ig strand F 2076..2081 CDD:409353 0/4 (0%)
Ig strand G 2089..2092 CDD:409353 0/4 (0%)
FN3 2100..2194 CDD:238020 14/94 (15%)
FN3 2203..2292 CDD:238020 13/110 (12%)
Ig 2314..2395 CDD:472250 24/107 (22%)
Ig strand B 2322..2326 CDD:409353 0/3 (0%)
Ig strand C 2335..2339 CDD:409353 2/4 (50%)
Ig strand E 2361..2365 CDD:409353 1/3 (33%)
Ig strand F 2375..2380 CDD:409353 0/4 (0%)
FN3 <2376..2753 CDD:442628 78/423 (18%)
Ig strand G 2388..2391 CDD:409353 2/2 (100%)
FN3 2501..2590 CDD:238020 15/88 (17%)
FN3 <2673..>2891 CDD:442628 33/217 (15%)
Ig 2902..2995 CDD:472250 22/94 (23%)
Ig strand B 2920..2924 CDD:409353 1/3 (33%)
Ig strand C 2933..2937 CDD:409353 0/3 (0%)
FN3 <2957..>3191 CDD:442628 32/239 (13%)
Ig strand E 2961..2965 CDD:409353 0/3 (0%)
Ig strand F 2975..2980 CDD:409353 1/4 (25%)
Ig strand G 2988..2991 CDD:409353 1/2 (50%)
FN3 2999..3088 CDD:238020 10/91 (11%)
Ig 3212..3292 CDD:472250 9/79 (11%)
Ig strand B 3220..3224 CDD:409353 0/3 (0%)
Ig strand C 3233..3237 CDD:409353 1/3 (33%)
Ig strand E 3258..3262 CDD:409353 0/3 (0%)
Ig strand F 3272..3277 CDD:409353 0/4 (0%)
Ig strand G 3285..3288 CDD:409353 0/2 (0%)
FN3 3296..3390 CDD:238020 20/96 (21%)
FN3 3400..3489 CDD:238020 7/88 (8%)
I-set 3494..3590 CDD:400151 26/103 (25%)
Ig strand B 3517..3521 CDD:409353 1/3 (33%)
Ig strand C 3530..3534 CDD:409353 2/3 (67%)
Ig strand E 3556..3560 CDD:409353 1/11 (9%)
Ig strand F 3570..3575 CDD:409353 1/4 (25%)
Ig strand G 3583..3586 CDD:409353 0/2 (0%)
FN3 3594..3682 CDD:238020 12/87 (14%)
FN3 3694..3781 CDD:238020 24/97 (25%)
I-set 3795..3885 CDD:400151 17/90 (19%)
Ig strand B 3813..3817 CDD:409353 0/3 (0%)
Ig strand C 3826..3830 CDD:409353 0/3 (0%)
Ig strand E 3851..3855 CDD:409353 0/3 (0%)
Ig strand F 3865..3870 CDD:409353 1/4 (25%)
FN3 <3866..4181 CDD:442628 45/314 (14%)
Ig strand G 3878..3881 CDD:409353 0/2 (0%)
FN3 4185..4271 CDD:238020 12/85 (14%)
FN3 4285..4383 CDD:238020 4/97 (4%)
FN3 4356..4776 CDD:442628 82/433 (19%)
FN3 4779..4863 CDD:238020 5/83 (6%)
FN3 4879..4970 CDD:238020 23/90 (26%)
Ig_3 4978..5056 CDD:464046 22/80 (28%)
FN3 <5021..>5264 CDD:442628 49/242 (20%)
FN3 5073..5166 CDD:238020 17/92 (18%)
Ig 5286..5366 CDD:472250 17/80 (21%)
Ig strand B 5294..5298 CDD:409353 0/3 (0%)
Ig strand C 5307..5311 CDD:409353 1/3 (33%)
Ig strand E 5332..5336 CDD:409353 0/3 (0%)
Ig strand F 5346..5351 CDD:409353 1/4 (25%)
Ig strand G 5359..5362 CDD:409353 0/2 (0%)
FN3 5370..5462 CDD:238020 8/91 (9%)
FN3 5470..5561 CDD:238020 19/95 (20%)
Ig 5559..5654 CDD:472250 26/100 (26%)
Ig strand B 5588..5592 CDD:409353 0/3 (0%)
Ig strand C 5601..5605 CDD:409353 0/3 (0%)
Ig strand E 5626..5630 CDD:409353 0/3 (0%)
Ig strand F 5640..5645 CDD:409353 1/4 (25%)
FN3 5664..5755 CDD:238020 9/90 (10%)
FN3 5764..5853 CDD:238020 23/89 (26%)
Ig 5874..5954 CDD:472250 18/82 (22%)
Ig strand B 5882..5886 CDD:409353 1/3 (33%)
Ig strand C 5895..5899 CDD:409353 0/3 (0%)
Ig strand E 5920..5924 CDD:409353 0/3 (0%)
Ig strand F 5934..5939 CDD:409353 1/4 (25%)
Ig strand G 5947..5950 CDD:409353 0/2 (0%)
FN3 <5972..>6384 CDD:442628 93/467 (20%)
Ig_Titin_like 6174..6255 CDD:409406 26/81 (32%)
Ig strand A 6174..6178 CDD:409406 0/3 (0%)
Ig strand B 6183..6189 CDD:409406 1/5 (20%)
Ig strand C 6195..6201 CDD:409406 2/5 (40%)
Ig strand D 6213..6218 CDD:409406 0/4 (0%)
Ig strand E 6219..6225 CDD:409406 1/6 (17%)
Ig strand F 6234..6242 CDD:409406 5/7 (71%)
FN3 <6236..6552 CDD:442628 86/400 (22%)
Ig strand G 6245..6255 CDD:409406 4/9 (44%)
Ig_Titin_like 6570..6650 CDD:409406 24/82 (29%)
Ig strand A 6570..6573 CDD:409406 0/2 (0%)
Ig strand B 6578..6584 CDD:409406 1/5 (20%)
Ig strand C 6590..6596 CDD:409406 2/5 (40%)
Ig strand D 6608..6613 CDD:409406 0/4 (0%)
Ig strand E 6614..6620 CDD:409406 1/5 (20%)
Ig strand F 6629..6637 CDD:409406 3/7 (43%)
FN3 <6630..7006 CDD:442628 73/387 (19%)
Ig strand G 6640..6650 CDD:409406 4/11 (36%)
FN3 <6905..>7189 CDD:442628 43/302 (14%)
FN3 7151..7237 CDD:238020 27/103 (26%)
Ig 7254..7344 CDD:472250 29/101 (29%)
Ig strand B 7271..7275 CDD:409353 1/3 (33%)
Ig strand C 7284..7288 CDD:409353 0/3 (0%)
Ig strand E 7310..7314 CDD:409353 2/3 (67%)
Ig strand F 7324..7329 CDD:409353 1/4 (25%)
Ig strand G 7337..7340 CDD:409353 1/2 (50%)
Ig 7361..7438 CDD:472250 25/80 (31%)
Ig strand B 7365..7369 CDD:409353 0/3 (0%)
Ig strand C 7378..7382 CDD:409353 0/3 (0%)
Ig strand E 7406..7410 CDD:409353 1/6 (17%)
Ig strand F 7420..7425 CDD:409353 1/4 (25%)
FN3 <7421..7762 CDD:442628 96/442 (22%)
Ig strand G 7433..7436 CDD:409353 0/2 (0%)
I-set 7648..7737 CDD:400151 19/93 (20%)
Ig strand B 7665..7669 CDD:409353 0/3 (0%)
Ig strand C 7678..7682 CDD:409353 2/4 (50%)
Ig strand E 7703..7707 CDD:409353 1/3 (33%)
Ig strand F 7717..7722 CDD:409353 2/4 (50%)
Ig strand G 7730..7733 CDD:409353 0/2 (0%)
Ig 7758..7833 CDD:472250 20/75 (27%)
Ig strand B 7761..7765 CDD:409353 0/3 (0%)
Ig strand C 7774..7778 CDD:409353 0/3 (0%)
Ig strand E 7799..7803 CDD:409353 1/3 (33%)
Ig strand F 7813..7818 CDD:409353 1/4 (25%)
Ig strand G 7826..7829 CDD:409353 1/2 (50%)
FN3 7837..7927 CDD:238020 6/89 (7%)
STKc_Twitchin_like 7986..8244 CDD:271016 93/268 (35%)
Ig 8313..8401 CDD:472250 28/133 (21%)
Ig strand B 8329..8333 CDD:409541 2/5 (40%)
Ig strand C 8342..8346 CDD:409541 1/8 (13%)
Ig strand E 8367..8371 CDD:409541 0/3 (0%)
Ig strand F 8381..8386 CDD:409541 2/4 (50%)
Ig strand G 8394..8397 CDD:409541 0/2 (0%)
I-set 8437..8525 CDD:400151 22/144 (15%)
Ig strand B 8454..8458 CDD:409353 0/3 (0%)
Ig strand C 8467..8471 CDD:409353 0/3 (0%)
Ig strand E 8491..8495 CDD:409353 2/3 (67%)
Ig strand F 8505..8510 CDD:409353 1/4 (25%)
Ig strand G 8518..8521 CDD:409353 0/2 (0%)
I-set 8632..8721 CDD:400151 30/88 (34%)
Ig strand B 8649..8653 CDD:409570 1/3 (33%)
Ig strand C 8662..8666 CDD:409570 0/3 (0%)
Ig strand E 8687..8691 CDD:409570 2/3 (67%)
Ig strand F 8701..8706 CDD:409570 1/4 (25%)
Ig strand G 8714..8717 CDD:409570 0/2 (0%)
I-set 8740..8831 CDD:400151 17/94 (18%)
Ig strand B 8757..8761 CDD:409353 1/3 (33%)
Ig strand C 8770..8774 CDD:409353 0/3 (0%)
Ig strand E 8795..8799 CDD:409353 1/3 (33%)
Ig strand F 8809..8814 CDD:409353 0/4 (0%)
Ig strand G 8822..8825 CDD:409353 1/2 (50%)
Ig 8839..8922 CDD:472250 8/35 (23%)
Ig strand B 8856..8860 CDD:409353 0/3 (0%)
Ig strand C 8868..8872 CDD:409353
Ig strand E 8894..8898 CDD:409353
unc-89NP_001020985.1 SH3 65..124 CDD:473055
RhoGEF 153..328 CDD:238091
PH_unc89 341..455 CDD:270134 10/41 (24%)
Ig strand B 565..569 CDD:409405 0/3 (0%)
I-set <570..638 CDD:400151 23/71 (32%)
Ig strand C 578..582 CDD:409405 1/3 (33%)
Ig strand E 604..608 CDD:409405 2/3 (67%)
Ig strand F 618..623 CDD:409405 1/4 (25%)
Ig strand G 631..634 CDD:409405 0/2 (0%)
I-set 648..737 CDD:400151 24/93 (26%)
Ig strand B 665..669 CDD:409353 1/3 (33%)
Ig strand C 678..682 CDD:409353 0/3 (0%)
Ig strand E 703..707 CDD:409353 2/3 (67%)
Ig strand F 717..722 CDD:409353 1/4 (25%)
Ig strand G 730..733 CDD:409353 0/2 (0%)
I-set 748..837 CDD:400151 23/95 (24%)
Ig strand B 765..769 CDD:409353 0/3 (0%)
Ig strand C 778..782 CDD:409353 1/3 (33%)
Ig strand E 803..807 CDD:409353 1/3 (33%)
Ig strand F 817..822 CDD:409353 1/4 (25%)
Ig strand G 830..833 CDD:409353 0/2 (0%)
Ig 844..935 CDD:472250 19/96 (20%)
Ig strand B 861..865 CDD:409405 0/3 (0%)
Ig strand C 874..878 CDD:409405 2/3 (67%)
Ig strand E 900..904 CDD:409405 1/3 (33%)
Ig strand F 915..920 CDD:409405 0/5 (0%)
Ig strand G 928..931 CDD:409405 0/2 (0%)
Ig 946..1034 CDD:472250 22/93 (24%)
Ig strand B 963..967 CDD:409543 0/3 (0%)
Ig strand C 976..980 CDD:409543 1/3 (33%)
Ig strand E 1002..1006 CDD:409543 0/3 (0%)
Ig strand F 1010..1019 CDD:409543 2/8 (25%)
Ig strand G 1027..1030 CDD:409543 0/2 (0%)
I-set 1044..1133 CDD:400151 24/93 (26%)
Ig strand B 1061..1065 CDD:409353 2/3 (67%)
Ig strand C 1074..1078 CDD:409353 1/3 (33%)
Ig strand E 1099..1103 CDD:409353 1/3 (33%)
Ig strand F 1113..1118 CDD:409353 0/4 (0%)
Ig strand G 1126..1129 CDD:409353 0/2 (0%)
Ig 1140..1237 CDD:472250 25/106 (24%)
Ig strand B 1157..1161 CDD:409543 0/3 (0%)
Ig strand C 1170..1174 CDD:409543 2/3 (67%)
Ig strand E 1200..1204 CDD:409543 1/4 (25%)
Ig strand F 1208..1222 CDD:409543 2/13 (15%)
Ig strand G 1230..1233 CDD:409543 1/2 (50%)
PTZ00121 <1304..1992 CDD:173412 171/747 (23%)
Ig 1982..2068 CDD:472250 16/91 (18%)
Ig strand B 1999..2003 CDD:409353 1/3 (33%)
Ig strand C 2010..2014 CDD:409353 0/3 (0%)
Ig strand E 2036..2040 CDD:409353 1/3 (33%)
Ig strand F 2048..2053 CDD:409353 0/4 (0%)
Ig strand G 2061..2064 CDD:409353 0/2 (0%)
I-set 2081..2164 CDD:400151 27/130 (21%)
Ig strand B 2092..2096 CDD:409406 1/3 (33%)
Ig strand C 2105..2109 CDD:409406 2/5 (40%)
Ig strand E 2130..2134 CDD:409406 1/3 (33%)
Ig strand F 2144..2149 CDD:409406 0/4 (0%)
Ig strand G 2157..2160 CDD:409406 0/2 (0%)
Ig 2171..2262 CDD:472250 21/90 (23%)
Ig strand B 2188..2192 CDD:409353 0/3 (0%)
Ig strand C 2202..2206 CDD:409353 0/3 (0%)
Ig strand E 2226..2232 CDD:409353 2/5 (40%)
Ig strand F 2242..2247 CDD:409353 1/4 (25%)
Ig strand G 2255..2258 CDD:409353 0/2 (0%)
I-set 2269..2360 CDD:400151 27/92 (29%)
Ig strand B 2286..2290 CDD:409405 1/3 (33%)
Ig strand C 2299..2303 CDD:409405 2/3 (67%)
Ig strand E 2326..2330 CDD:409405 0/3 (0%)
Ig strand F 2340..2345 CDD:409405 1/4 (25%)
Ig strand G 2353..2356 CDD:409405 0/2 (0%)
I-set 2367..2456 CDD:400151 21/90 (23%)
Ig strand B 2384..2388 CDD:409543 1/3 (33%)
Ig strand C 2397..2401 CDD:409543 1/3 (33%)
Ig strand E 2422..2426 CDD:409543 0/3 (0%)
Ig strand F 2436..2441 CDD:409543 1/4 (25%)
Ig strand G 2449..2452 CDD:409543 0/2 (0%)
Ig 2463..2554 CDD:472250 20/90 (22%)
Ig strand B 2480..2484 CDD:409405 0/3 (0%)
Ig strand C 2494..2498 CDD:409405 0/3 (0%)
Ig strand E 2520..2524 CDD:409405 1/3 (33%)
Ig strand F 2534..2539 CDD:409405 2/4 (50%)
Ig strand G 2547..2550 CDD:409405 0/2 (0%)
Ig 2563..2652 CDD:472250 18/88 (20%)
Ig strand C 2593..2597 CDD:409405 0/3 (0%)
Ig strand E 2618..2622 CDD:409405 1/3 (33%)
Ig strand F 2632..2637 CDD:409405 0/4 (0%)
Ig strand G 2645..2648 CDD:409405 0/2 (0%)
I-set 2659..2747 CDD:400151 21/200 (11%)
Ig strand B 2675..2679 CDD:409543 1/11 (9%)
Ig strand C 2688..2692 CDD:409543 1/60 (2%)
Ig strand E 2713..2717 CDD:409543 1/3 (33%)
Ig strand F 2727..2732 CDD:409543 0/4 (0%)
Ig strand G 2740..2743 CDD:409543 0/2 (0%)
Ig 2754..2843 CDD:472250 24/107 (22%)
Ig strand C 2784..2788 CDD:409353 1/3 (33%)
Ig strand E 2809..2813 CDD:409353 1/3 (33%)
Ig strand F 2824..2829 CDD:409353 0/4 (0%)
Ig strand G 2837..2840 CDD:409353 0/2 (0%)
I-set 2887..2981 CDD:400151 23/116 (20%)
Ig strand B 2904..2908 CDD:409405 0/3 (0%)
Ig strand C 2917..2921 CDD:409405 1/3 (33%)
Ig strand E 2947..2951 CDD:409405 1/3 (33%)
Ig strand F 2961..2966 CDD:409405 1/4 (25%)
Ig strand G 2974..2977 CDD:409405 1/2 (50%)
I-set 2994..3082 CDD:400151 33/167 (20%)
Ig strand B 3011..3015 CDD:409353 1/25 (4%)
Ig strand C 3024..3028 CDD:409353 1/5 (20%)
Ig strand E 3046..3052 CDD:409353 0/5 (0%)
Ig strand F 3062..3067 CDD:409353 2/4 (50%)
Ig strand G 3075..3078 CDD:409353 0/2 (0%)
Ig 3087..3183 CDD:472250 25/191 (13%)
Ig strand B 3104..3108 CDD:409543 0/3 (0%)
Ig strand C 3117..3121 CDD:409543 0/3 (0%)
Ig strand E 3149..3154 CDD:409543 1/4 (25%)
Ig strand F 3164..3169 CDD:409543 1/9 (11%)
I-set 3189..3279 CDD:400151 22/93 (24%)
Ig strand B 3206..3210 CDD:409405 1/3 (33%)
Ig strand C 3218..3222 CDD:409405 0/3 (0%)
Ig strand E 3245..3249 CDD:409405 0/3 (0%)
Ig strand F 3259..3264 CDD:409405 1/4 (25%)
Ig strand G 3272..3275 CDD:409405 1/2 (50%)
I-set 3286..3377 CDD:400151 25/194 (13%)
Ig strand B 3303..3307 CDD:409353 0/3 (0%)
Ig strand C 3316..3320 CDD:409353 0/3 (0%)
Ig strand E 3343..3347 CDD:409353 0/3 (0%)
Ig strand F 3357..3362 CDD:409353 0/4 (0%)
Ig strand G 3370..3373 CDD:409353 1/2 (50%)
I-set 3384..3472 CDD:400151 32/192 (17%)
Ig strand B 3401..3405 CDD:409405 0/3 (0%)
Ig strand C 3414..3418 CDD:409405 1/3 (33%)
Ig strand E 3441..3445 CDD:409405 1/7 (14%)
Ig strand F 3455..3460 CDD:409405 1/14 (7%)
Ig strand G 3468..3471 CDD:409405 1/2 (50%)
I-set 3482..3573 CDD:400151 28/113 (25%)
Ig strand B 3499..3503 CDD:409353 1/3 (33%)
Ig strand C 3512..3516 CDD:409353 2/3 (67%)
Ig strand E 3539..3543 CDD:409353 0/3 (0%)
Ig strand F 3553..3558 CDD:409353 1/4 (25%)
Ig strand G 3566..3569 CDD:409353 0/2 (0%)
I-set 3580..3671 CDD:400151 35/185 (19%)
Ig strand B 3597..3601 CDD:409405 0/3 (0%)
Ig strand C 3610..3614 CDD:409405 0/3 (0%)
Ig strand E 3637..3641 CDD:409405 1/3 (33%)
Ig strand F 3651..3656 CDD:409405 0/4 (0%)
Ig strand G 3664..3667 CDD:409405 0/2 (0%)
I-set 3686..3776 CDD:400151 19/95 (20%)
Ig strand B 3703..3707 CDD:409353 0/3 (0%)
Ig strand C 3716..3720 CDD:409353 0/3 (0%)
Ig strand E 3742..3746 CDD:409353 0/3 (0%)
Ig strand F 3756..3761 CDD:409353 1/4 (25%)
Ig strand G 3769..3772 CDD:409353 0/2 (0%)
I-set 3817..3902 CDD:400151 28/193 (15%)
Ig strand B 3834..3838 CDD:409543 1/8 (13%)
Ig strand C 3847..3851 CDD:409543 2/3 (67%)
Ig strand E 3873..3877 CDD:409543 0/3 (0%)
Ig strand F 3887..3892 CDD:409543 1/4 (25%)
Ig strand G 3900..3903 CDD:409543 0/2 (0%)
I-set 3920..4010 CDD:400151 29/266 (11%)
Ig strand B 3937..3941 CDD:409353 1/3 (33%)
Ig strand C 3950..3954 CDD:409353 1/3 (33%)
Ig strand E 3974..3980 CDD:409353 1/5 (20%)
Ig strand F 3990..3995 CDD:409353 1/4 (25%)
Ig strand G 4003..4006 CDD:409353 0/2 (0%)
I-set 4018..4107 CDD:400151 31/163 (19%)
Ig strand B 4035..4039 CDD:409353 1/3 (33%)
Ig strand C 4047..4051 CDD:409353 1/14 (7%)
Ig strand E 4073..4077 CDD:409353 1/6 (17%)
Ig strand F 4087..4092 CDD:409353 1/8 (13%)
Ig strand G 4100..4103 CDD:409353 2/2 (100%)
Ig 4114..4202 CDD:472250 24/103 (23%)
Ig strand B 4130..4134 CDD:409353 1/3 (33%)
Ig strand C 4142..4146 CDD:409353 1/3 (33%)
Ig strand F 4182..4187 CDD:409353 2/4 (50%)
Ig strand G 4195..4198 CDD:409353 0/2 (0%)
Ig 4212..4298 CDD:472250 34/195 (17%)
Ig strand B 4229..4233 CDD:409543 2/3 (67%)
Ig strand C 4241..4245 CDD:409543 1/6 (17%)
Ig strand E 4264..4268 CDD:409543 0/3 (0%)
Ig strand F 4278..4283 CDD:409543 1/4 (25%)
Ig strand G 4291..4294 CDD:409543 0/2 (0%)
I-set 4302..4388 CDD:400151 33/116 (28%)
Ig strand B 4319..4323 CDD:409543 2/3 (67%)
Ig strand C 4331..4335 CDD:409543 1/3 (33%)
Ig strand E 4354..4358 CDD:409543 1/3 (33%)
Ig strand F 4368..4373 CDD:409543 3/4 (75%)
Ig strand G 4381..4384 CDD:409543 0/2 (0%)
I-set 4400..4486 CDD:400151 30/158 (19%)
Ig strand B 4417..4421 CDD:409543 1/3 (33%)
Ig strand C 4429..4433 CDD:409543 1/3 (33%)
Ig strand E 4452..4456 CDD:409543 2/21 (10%)
Ig strand F 4466..4471 CDD:409543 1/4 (25%)
Ig strand G 4479..4482 CDD:409543 0/2 (0%)
Ig 4493..4582 CDD:472250 23/122 (19%)
Ig strand B 4508..4512 CDD:409543 0/3 (0%)
Ig strand C 4520..4524 CDD:409543 1/4 (25%)
Ig strand E 4546..4550 CDD:409543 0/3 (0%)
Ig strand F 4560..4565 CDD:409543 3/19 (16%)
Ig strand G 4574..4577 CDD:409543 0/2 (0%)
Ig 4588..4679 CDD:472250 23/161 (14%)
Ig strand B 4605..4609 CDD:409543 0/3 (0%)
Ig strand C 4617..4621 CDD:409543 0/3 (0%)
Ig strand E 4645..4649 CDD:409543 1/3 (33%)
Ig strand F 4659..4664 CDD:409543 1/4 (25%)
Ig strand G 4672..4675 CDD:409543 1/3 (33%)
I-set 4685..4772 CDD:400151 26/98 (27%)
Ig strand B 4700..4704 CDD:409543 0/3 (0%)
Ig strand C 4712..4716 CDD:409543 0/3 (0%)
Ig strand E 4738..4742 CDD:409543 0/3 (0%)
Ig strand F 4752..4757 CDD:409543 1/4 (25%)
Ig strand G 4765..4768 CDD:409543 0/2 (0%)
Ig 4781..4869 CDD:472250 31/181 (17%)
Ig strand B 4797..4801 CDD:409353 2/9 (22%)
Ig strand C 4810..4813 CDD:409353 0/2 (0%)
Ig strand E 4835..4839 CDD:409353 1/3 (33%)
Ig strand F 4849..4854 CDD:409353 2/4 (50%)
Ig strand G 4862..4865 CDD:409353 1/3 (33%)
Ig 4873..4962 CDD:472250 21/91 (23%)
Ig strand B 4890..4894 CDD:409543 1/3 (33%)
Ig strand C 4902..4906 CDD:409543 0/3 (0%)
Ig strand E 4928..4932 CDD:409543 0/3 (0%)
Ig strand F 4942..4947 CDD:409543 1/4 (25%)
Ig strand G 4955..4958 CDD:409543 0/2 (0%)
Ig 4979..5060 CDD:472250 25/97 (26%)
Ig strand B 4985..4989 CDD:409543 2/3 (67%)
Ig strand C 4997..5001 CDD:409543 2/3 (67%)
Ig strand E 5025..5029 CDD:409543 0/3 (0%)
Ig strand F 5039..5044 CDD:409543 0/4 (0%)
Ig strand G 5052..5055 CDD:409543 0/2 (0%)
I-set 5073..5161 CDD:400151 28/100 (28%)
Ig strand B 5088..5092 CDD:409353 1/3 (33%)
Ig strand C 5101..5105 CDD:409353 0/3 (0%)
Ig strand E 5127..5131 CDD:409353 0/3 (0%)
Ig strand F 5141..5146 CDD:409353 2/4 (50%)
Ig strand G 5154..5157 CDD:409353 1/2 (50%)
I-set 5171..5260 CDD:400151 14/98 (14%)
Ig strand B 5188..5192 CDD:409405 0/3 (0%)
Ig strand C 5201..5205 CDD:409405 1/3 (33%)
Ig strand E 5227..5231 CDD:409405 1/3 (33%)
Ig strand F 5241..5246 CDD:409405 0/4 (0%)
Ig strand G 5256..5259 CDD:409405 1/7 (14%)
Ig 5277..5367 CDD:472250 25/123 (20%)
Ig strand B 5294..5298 CDD:409353 0/3 (0%)
Ig strand C 5307..5311 CDD:409353 1/3 (33%)
Ig strand E 5333..5337 CDD:409353 0/3 (0%)
Ig strand F 5347..5352 CDD:409353 0/4 (0%)
Ig strand G 5360..5363 CDD:409353 0/2 (0%)
I-set 5383..5473 CDD:400151 25/107 (23%)
Ig strand B 5400..5404 CDD:409353 1/3 (33%)
Ig strand C 5413..5417 CDD:409353 0/3 (0%)
Ig strand E 5439..5443 CDD:409353 0/3 (0%)
Ig strand F 5453..5458 CDD:409353 1/4 (25%)
Ig strand G 5466..5469 CDD:409353 0/2 (0%)
I-set 5487..5577 CDD:400151 27/90 (30%)
Ig strand B 5504..5508 CDD:409353 1/3 (33%)
Ig strand C 5517..5521 CDD:409353 0/3 (0%)
Ig strand E 5543..5547 CDD:409353 1/3 (33%)
Ig strand F 5557..5562 CDD:409353 2/4 (50%)
Ig strand G 5571..5574 CDD:409353 0/2 (0%)
I-set 5595..5684 CDD:400151 26/165 (16%)
Ig strand C 5625..5629 CDD:409353 0/3 (0%)
Ig strand E 5650..5656 CDD:409353 2/11 (18%)
Ig strand F 5666..5671 CDD:409353 1/4 (25%)
Ig strand G 5680..5683 CDD:409353 0/2 (0%)
I-set 5701..5791 CDD:400151 27/114 (24%)
Ig strand B 5718..5722 CDD:409405 0/3 (0%)
Ig strand C 5731..5735 CDD:409405 0/3 (0%)
Ig strand E 5757..5761 CDD:409405 0/3 (0%)
Ig strand F 5771..5776 CDD:409405 1/4 (25%)
Ig 5815..5905 CDD:472250 31/176 (18%)
Ig strand B 5832..5836 CDD:409543 2/3 (67%)
Ig strand C 5845..5849 CDD:409543 2/11 (18%)
Ig strand E 5871..5875 CDD:409543 0/3 (0%)
Ig strand F 5885..5890 CDD:409543 1/4 (25%)
Ig strand G 5898..5901 CDD:409543 1/2 (50%)
I-set 5925..6015 CDD:400151 29/95 (31%)
Ig strand B 5942..5946 CDD:409405 1/3 (33%)
Ig strand C 5955..5959 CDD:409405 0/3 (0%)
Ig strand E 5981..5985 CDD:409405 2/3 (67%)
Ig strand F 5995..6000 CDD:409405 1/4 (25%)
Ig strand G 6008..6011 CDD:409405 1/2 (50%)
I-set 6038..6131 CDD:400151 25/95 (26%)
Ig strand B 6055..6059 CDD:409353 0/3 (0%)
Ig strand C 6068..6072 CDD:409353 0/3 (0%)
Ig strand E 6097..6101 CDD:409353 0/3 (0%)
Ig strand F 6111..6116 CDD:409353 1/4 (25%)
Ig strand G 6124..6127 CDD:409353 0/2 (0%)
Ig 6150..6240 CDD:472250 22/106 (21%)
Ig strand B 6167..6171 CDD:409405 1/4 (25%)
Ig strand C 6180..6184 CDD:409405 1/3 (33%)
Ig strand E 6206..6210 CDD:409405 0/3 (0%)
Ig strand F 6220..6225 CDD:409405 2/6 (33%)
Ig strand G 6233..6236 CDD:409405 0/2 (0%)
FN3 6275..6358 CDD:214495 24/87 (28%)
Ig <6433..6495 CDD:472250 16/62 (26%)
Ig strand C 6440..6444 CDD:409543 1/3 (33%)
Ig strand E 6469..6473 CDD:409543 1/3 (33%)
Ig strand F 6483..6488 CDD:409543 2/4 (50%)
IgI_telokin-like 6510..6597 CDD:409565 26/169 (15%)
Ig strand A 6510..6513 CDD:409565 0/2 (0%)
Ig strand A' 6515..6518 CDD:409565 1/4 (25%)
Ig strand B 6522..6531 CDD:409565 0/8 (0%)
Ig strand C 6536..6542 CDD:409565 2/5 (40%)
Ig strand C' 6545..6547 CDD:409565 0/1 (0%)
Ig strand D 6553..6558 CDD:409565 1/4 (25%)
Ig strand E 6561..6569 CDD:409565 3/7 (43%)
Ig strand F 6577..6584 CDD:409565 2/6 (33%)
Ig strand G 6587..6597 CDD:409565 5/90 (6%)
PK_Unc-89_rpt1 6620..6878 CDD:271011 97/316 (31%)
I-set 7528..7616 CDD:400151 29/87 (33%)
Ig strand B 7545..7549 CDD:409405 1/3 (33%)
Ig strand C 7558..7562 CDD:409405 0/3 (0%)
Ig strand E 7583..7587 CDD:409405 2/3 (67%)
Ig strand F 7597..7602 CDD:409405 1/4 (25%)
Ig strand G 7610..7613 CDD:409405 0/2 (0%)
FN3 7621..7716 CDD:238020 18/113 (16%)
STKc_Unc-89_rpt2 7781..8035 CDD:271014
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.