DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bt and hmcn2

DIOPT Version :9

Sequence 1:NP_001162825.1 Gene:bt / 43814 FlyBaseID:FBgn0005666 Length:8933 Species:Drosophila melanogaster
Sequence 2:XP_031747766.1 Gene:hmcn2 / 100490941 XenbaseID:XB-GENE-6034990 Length:4625 Species:Xenopus tropicalis


Alignment Length:4819 Identity:935/4819 - (19%)
Similarity:1534/4819 - (31%) Gaps:1655/4819 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly  4477 QINIITKPGKPEGPLEVSEV------HKDGCKLKWKKPKDDGGEPVESYLVEKFDP---DTGIWL 4532
            |:|.:.|  ..|..::.|:|      |:...:..|..|               |||   :..|.|
 Frog   191 QVNEVLK--WVEEAIQASKVHLLSTDHELAAERSWNIP---------------FDPSLKEVTISL 238

  Fly  4533 PVGRSDGPEYNVDGLVPGHDYKFRVKAVNKEGESEPLETLGSIIAKDPFSV------PTKPGVPE 4591
                 .||:.:::.:.|..    |:.|:||     .||.|.||    |.|.      |:.|||  
 Frog   239 -----SGPKPHIEVIDPAG----RIYALNK-----GLEELLSI----PNSALIVGLKPSMPGV-- 283

  Fly  4592 PTDWTANKVELAWPEPASDGGSPIQGYIVEVKDKYSPLWEKALETNSPTPTATVQGLIEGNEYQF 4656
               ||. |:       :|.|...::...|...|..:.....||...|.|....:||:        
 Frog   284 ---WTI-KI-------SSSGRHTVRITGVSFLDFRAAFSTAALIDPSNTIERPIQGV-------- 329

  Fly  4657 RVVAL-NKGGLSEPSDPSKIFTAKPRYLAPKIDRRNLRNITLSSGTALKLDANITGE-----PAP 4715
            .:.|| |..||:.|.               |:|..:|              ..::||     ||.
 Frog   330 PISALINCTGLAPPG---------------KVDSLDL--------------LRVSGEPFFSLPAQ 365

  Fly  4716 KVEWKLSNY-----HLQSGKNVTIETPDYYTKLVIRPTQRSDSGEYLVTATNTSGKDSVLVNVVI 4775
            ::.:|.|..     |.|:.:.      .::.|:     ..:|.|.|.....:     ||....:|
 Frog   366 RLPYKRSKQLWSVPHFQAPRE------SFFMKV-----NGTDRGGYPFQRLS-----SVAYTSII 414

  Fly  4776 TDKPSPPNGPLQISDVHKE----GCHLKWKRP-----SDDGGTPIEYFQIDKLEPETG--CW-IP 4828
            .|.|: ...|..|...|:.    .|.:..:.|     |.||    |....|:...|:|  .| ||
 Frog   415 PDIPT-VFMPELIQGYHERLLRLTCSVLSEIPFRLRFSKDG----ERLGEDQFFMESGNATWEIP 474

  Fly  4829 SCRSTEPQVDVTGLSPGNEYKFRVSAVNAEGESQPLVGDESIVARNPFDEPGKPENLKATDWDKD 4893
            |.            |..:|..:..:|::..|..                            :.:.
 Frog   475 SA------------SARHEGTYLCTAMSKAGGG----------------------------YART 499

  Fly  4894 HVDLAWTPPLID---------GGSPI-SCYII------------EKQDKYGKWERALDVPADQCK 4936
            .|.:|..||.:.         |||.| ||.::            .|..:.|:.....:...:...
 Frog   500 KVSVADPPPTLAVTHNITTFVGGSAILSCEVLGEIRYNLTWAHSGKAFREGRVRILANSSLEILN 564

  Fly  4937 ATIPDLVEGQTYKFRVSAVNAAGTGEPSDSTPPIIAKARNKPPIID-RSSLVEVRIKAGQSFTFD 5000
            |...|..|     ::.:|.|..|      :|...:......||.|: :||  .:::..|:..|..
 Frog   565 AQASDAGE-----YQCTASNDHG------ATTASLWLTIQAPPSIEIKSS--SMQLSHGEEVTLR 616

  Fly  5001 CKVSGEPAPQTKWLLKKKEVYSKDNVKVTNVDYNTKLKVNSATRSDSGIYTVFAENANGEDSADV 5065
            |.|||.|.||..|  |.::.:..:..:.|.:| |:.|.:..|.:.|:|.|:..|.|:.|.|...|
 Frog   617 CDVSGNPVPQVSW--KHEDSFLSNGSRYTVLD-NSTLLIKDAGQEDAGNYSCVASNSLGTDEQTV 678

  Fly  5066 KVTVIDKPAPPNGPLKVDEINSESCTLHWNPPDDDGGQPIDNYVVEKLDETTGRWIPAGETDGPV 5130
            .:|.:::|       |...:.:    |...|..:|.       ::|.|.|               
 Frog   679 FLTYVERP-------KATAVKA----LVLVPLGEDA-------ILECLSE--------------- 710

  Fly  5131 TALKVGGLTPGHKYKFRVRAKNRQGTSEPLTTAQAIIAKNPFDVPTKPGTPTIKDFDKEFVDLEW 5195
                  ||.|                  |:.|                   ..|| |||   :..
 Frog   711 ------GLPP------------------PVVT-------------------WYKD-DKE---VTG 728

  Fly  5196 TRPEADGGSPITGYVVEKRDKFSPDWEKCAEISDDITNAHVPDLIEGLKYEFRVRAVNKAGPGSP 5260
            |....:||:                 .|..|:..:          :|.||    ..|.....|:.
 Frog   729 TESGTNGGT-----------------LKLQEVRAE----------DGGKY----ACVASNNAGTA 762

  Fly  5261 SDATETHVARPKNTPPK-IDRNFMSDIKIKAGNVFEFDVPVTGEPLPSKDWTHEGNMIINTDRVK 5324
            ||..:..|    .|||: ||  |..|::::.|:.........|.|.|...|.             
 Frog   763 SDIIQVDV----GTPPQFID--FPLDVEVEVGDSASLPCSAEGNPTPQVSWF------------- 808

  Fly  5325 ISNFDDRTKIRILDAKRSDTGVYTLTARNINGTDRHNVKVTILDAPSVPEGPLRNGDVSKNSIVL 5389
                            |.|.|                        |.||.|        ...|: 
 Frog   809 ----------------RQDEG------------------------PVVPSG--------TTEII- 824

  Fly  5390 RWRPPKDDGGSEITHYVVEKMDNEAMRWVPVGDCTDTEIRADNLIENHDYSFRVRAVNKQGQSQP 5454
                  :..||...|:.|.:.::.|:                                       
 Frog   825 ------EGPGSNTVHFKVARPEDAAV--------------------------------------- 844

  Fly  5455 LTTSQPITAKDPYSHPDKPGQPQATDWGKHFVDLEWSTPKRDGGAPISSYIIEKRPKFGQWERAA 5519
                                                             |:.|.|..|| |.:|.
 Frog   845 -------------------------------------------------YVCEARNAFG-WVQAE 859

  Fly  5520 VVLGDNCKAHVPELTNGGEYEFRVIAVNRGGPSDPSDPSSTIICKPRFLAPFFDKSLLNDITVHA 5584
            ::|                                   |.|.:..|:...      ..:::||..
 Frog   860 ILL-----------------------------------SVTGLAAPKLAV------ASSEVTVLE 883

  Fly  5585 GKRLGWTLP---IEASPRPLITWLYNGKEIGSNSR----GESGLFQNELTFEIVSSLRSDEGRYT 5642
            |..:  |||   :..:|.|:..|..|.:.:....|    ||.||.       |....|.|.|:|.
 Frog   884 GHSV--TLPCTVVSGNPLPVQRWTKNSEALQVQWRHSINGEGGLL-------IEPVQREDAGKYF 939

  Fly  5643 LILKNEHGSFDASAHATVLDRPSPPKGPLDITKITRDG------CH--------LTWNVPDDDGG 5693
            ..:.|..||.:.|....|...|....||.:.  :.|:|      |.        :||:..|.:..
 Frog   940 CEVTNAAGSTNHSILLHVHVAPVILSGPAEY--VVREGRAVIMSCDVKGYPPPTVTWSKGDLELT 1002

  Fly  5694 SPILHYIIEK---MDLSRSTWSDAGMST--------HIVHDVTRLVHRKEYLFRVKAVNAIGESD 5747
            ....||.:.|   :.:|..|.:|.|..|        ..:.||..:||.|..:    ::|  |..|
 Frog  1003 QENTHYYLNKDGSIMISLPTGADGGSYTCKAVNPAGVSIRDVRLIVHTKPRI----SIN--GSHD 1061

  Fly  5748 PLEAVNTIIA-KNEFDEP-DAPGKPI-ITDWDRDHIDLQWAVPKSDGGAPISEYIIQKKEKGSPY 5809
            ....|..:.| ..|...| |..|.|: :..|.:|.:.|.               |:..:....|.
 Frog  1062 QNAPVRVVAALGTEITLPCDVEGSPLPVVSWRKDSLPLP---------------IVSARHHLLPS 1111

  Fly  5810 WTNVRHVPSNKNTTTIPELTEGQEYEFRVIAVNQAGQSEPSEPSDMIMAKPRYLPPKIITPLNEV 5874
            |           :..:.||.......:..:|.|.||.:..:...::      .:||::......:
 Frog  1112 W-----------SLRLSELRVMDSGYYSCLASNPAGNTSLTYSLEV------QVPPRVHPGAKVL 1159

  Fly  5875 RIKCGLIFHTDIHFIGEPAPEATWTLNSNPLLSNDRSTITSIGHHSVVHTVNCQRSDSGIYHLLL 5939
            :...|..........|:|.|..:|..:..|:...|:.::.  |....:..:..|.||||.|..:.
 Frog  1160 KALLGRTLQLPCLAYGDPMPRLSWYKDGEPMRVGDQDSLQ--GPDGSISVLEVQLSDSGNYRCVA 1222

  Fly  5940 RNSSGIDEGSFELVVLDRPGPPEGPMEYEEITANSVTISWKPPKDNGGSEISSYVIEKRDLTHGG 6004
            .:|:|.|...|.|.||:.|       .:|:                 ||::              
 Frog  1223 TSSAGEDSLEFRLEVLEAP-------TFED-----------------GSDV-------------- 1249

  Fly  6005 GWVPAVNYVSAKYNHAVVPRLLEGTMYELRVMAENLQGRSDPLTSDQPVVAKSQYTVPGAPGKPE 6069
                                |||.|.||..::...:||...||..   .:......|...||..:
 Frog  1250 --------------------LLEQTAYEPVILTCPVQGTPTPLIR---WMKNGVVLVGNLPGMTQ 1291

  Fly  6070 LTDSDKNHITIKWKQPISNGGSPIIGYDIERRDVNTGRWIKINGQPVPTAEYQDDRVTSNHQYQY 6134
            |                 ..||.:|                  ..|||           ||...|
 Frog  1292 L-----------------GNGSLLI------------------ESPVP-----------NHGGDY 1310

  Fly  6135 RISAVNAAGNGKTSEPSAIFNARPLREKPRFYFDGLIGKRIKVRAGEPVNLNIPISGAPTPTIEW 6199
            ...|.|.||:.:......::      .||:.:.||. ||.|.|.|.:|:.|...:||.|.||:.|
 Frog  1311 ICVATNEAGSARRKTKLVVY------AKPKIFEDGQ-GKNISVMANQPLTLRCEVSGVPFPTVTW 1368

  Fly  6200 KRGDLKLEEGKRISYETNSERTLF-RIDDSNRRDSGKYTVTAANEFGKDTADIEVIVVDKPSPPE 6263
            .:....|.|...:|.....:...| ||   .:.|:|.||..|.|..|:......::::..||...
 Frog  1369 SKDGKALTEAPGLSLLAAGQSVRFHRI---RKDDTGSYTCKAVNRAGEAQRTFNLMILVPPSIYG 1430

  Fly  6264 GPLSYTETAPD--HISLHWYSPKDDGGSDITGYIIEFTEFGVDDWKPVPGTCPNTNFTVKNLVEG 6326
            .......||.|  .:.||..:      |.:....:|:|:    |.:|:|....:...|     ||
 Frog  1431 AGSLQDMTARDGSEVELHCKA------SGVPRPQVEWTK----DGQPLPPGDAHIQLT-----EG 1480

  Fly  6327 KKYVFRIRAENIYGASEALEGK-PVLAKSPFDPPG---------APSQPTI--SAYTPNSANLEW 6379
            .:.:      .:.|...:.:|: ..||   |:..|         ..:.|||  |..|...|:|  
 Frog  1481 GQVL------QLNGTRLSDQGRYQCLA---FNHAGQQVKDFNLRVHTPPTIWASNETTEVASL-- 1534

  Fly  6380 HPPDDCGGKPITGYIVERRER------GGEWIKCNNYPTPNTSYTVSNLRDGAR--YEFRVL--- 6433
                      :.|.:..|.|.      |..|.|...   |..|.:.:..|:|.|  ...|||   
 Frog  1535 ----------LHGTVELRCEARASPVPGITWFKDKR---PIVSSSRATYREGGRSLQLSRVLLSD 1586

  Fly  6434 -------AVNEAGPGHPSKPSDPMTAEHQRYR------PD------PPEPPK------------- 6466
                   |.|.||           ||| :.||      ||      .|.|.|             
 Frog  1587 VGTYTCRATNNAG-----------TAE-KSYRLEVYVSPDIEGGGSKPLPIKAILGQALELECSA 1639

  Fly  6467 ----PDRIT--RNGVTLSWRPPRTDGKSRIKGYYVEMRPKNGKDWKTVNDIPINSTVYTVPSLKE 6525
                |..::  ::|:.||.|    ||          ::.|:|           ..|:| :..:.|
 Frog  1640 TGHPPPTLSWLKDGLMLSER----DG----------LQIKDG-----------GRTLY-IGIVSE 1678

  Fly  6526 GEEYSFRVVAENEVGRSDPSKPSQPITIEEQPNKPCMELGKVRD-IVCRAGD--DFSIHVPYLAF 6587
            |.:.:|..||.:..|.   :.....:|:...|.   :.:|:..: :...|.|  |.|.|.  ..:
 Frog  1679 GTQGTFTCVAISLAGE---NVLHYTVTVLVPPK---VVIGEGSEHVTVTANDPLDLSCHA--TGY 1735

  Fly  6588 PKPNAFWYSNDNMLDDNNRVHKHLTDDAASVVVKNSKRADSGQYRLQLKNTSGFDTATINVRVLD 6652
            |.|...|..|::.|...:.|  .:.:....:.::..:...:|:|:.:.:..||...|.:.|.|.:
 Frog  1736 PTPTIQWLRNNHSLSHEDGV--EVLNGGKMLTIRQIQPEHAGKYKCKAEGDSGTAEAWVEVEVQE 1798

  Fly  6653 RPSPPTRLRADEFSGDSLTLYWNPPNDDGGSAIQNYI--------IEKKEARSSTWSKVSSFCTV 6709
            .|              |:|:      ..|.:.:.|::        :......|.||.|......|
 Frog  1799 LP--------------SVTI------AGGTTMVVNFLKRVVLECDVSGSPPPSVTWWKDGFLLPV 1843

  Fly  6710 --PFVRIRNLVLNKEYDFRVIAENKYGQS--------------DPANTSEPILARHPFDIPNTPG 6758
              |.::|.::.::.|..:..:|.|..|:.              :|::.::.:       |.|.|.
 Frog  1844 QGPKLQIDSVSIDDEGVYTCVATNFAGEGRQDVVLTVLVSPNIEPSDVNQTV-------IENLPA 1901

  Fly  6759 IPHGIDSTEDSITIAWTKPKHDGGSPITGYIIEKRLLSDDKWTKAVHALCPDLSCKIPNLIENAE 6823
            ....:.|......::|.:     |..:........||::.|..:...|...|..           
 Frog  1902 SFECLASGSPLPLVSWYR-----GEQLLSAAPGITLLNEGKTLQIESAKSSDSG----------- 1950

  Fly  6824 YEFRVAAVNAAGQSAYSGSSDLIFCRRPPHAPKITSDLSIRDMTVIAGDEFRITVPYHASPRPTA 6888
             |:|..|.|.|      ||::|.:......||:|.|.:..  .|.:..::..:.......|.|..
 Frog  1951 -EYRCVASNTA------GSTELQYNLLVNVAPRIVSMMDF--ATFLVNEQVWLECNATGVPEPAI 2006

  Fly  6889 SW---------SLNGLEVIPGERIKFDSNDYASMYYNKSAKRDETGSYTITLTNNKGSDTASCHV 6944
            .|         ::.||:::...||       .|:   ::|...::|.|:....|..|.|  |.|:
 Frog  2007 MWLKDQVPVSTAIAGLQIMEQGRI-------LSL---RAAHVSDSGIYSCVAVNPAGED--SHHI 2059

  Fly  6945 TV------------------VDRPL---------PPQGPLNAYDITPDTCTLAWKTPLDDGGSPI 6982
            .:                  |::||         ||  ||           :.|   |.||...:
 Frog  2060 ALQVFVPPTIMGEELNSSIAVNQPLLLECQSTAIPP--PL-----------ITW---LKDGRPLL 2108

  Fly  6983 TNYVVEKLDNSGSWVKISS--------FVRNTHYDVMGLEPHYKYNFRVRAENQYGLSDPLDIIE 7039
            ....|:.:|: |.:::|..        :......|....|.||.....|          |....|
 Frog  2109 QRPGVQVIDD-GHYLQIDQAQLRDAGRYTCEASNDAGRTEKHYNVIIWV----------PPSFPE 2162

  Fly  7040 PIVAKHQFTVPDEPGQPKVIDWDSGNV---TLIWTR---PL--------SDGGSRIQGYQIEYRD 7090
            |....|...    .|||.....:...|   ||.||:   ||        |.||..:|..:::..|
 Frog  2163 PSAPHHSII----EGQPVSFTCECTGVPPPTLTWTKNGLPLTVEDSGLVSAGGRLLQIGKVQLSD 2223

  Fly  7091 ILNDSSWNAYDYIIKDTKYQLYNLINGSEYEFRIKAK-NAAGLSKPSSPSLRFKLKGKFT----V 7150
               :.|:      |.:...|..:  |..||...:.|: ..||.|  ::|......||...    |
 Frog  2224 ---EGSY------ICECSNQAGS--NKKEYWLEVYAQPMIAGSS--NTPKQLMVNKGSLVTMECV 2275

  Fly  7151 PSPPGAPQVTRVGKNYVDLKWEKPLRDG--------GSRITGYIIERRDIGGAVWVKCNDYNVLD 7207
            .|...:|.||.:...|       ||.:|        |.::|....:....|..|.|         
 Frog  2276 VSGKPSPSVTWLKDGY-------PLGNGPDLFFQNKGQQLTILKAQPSHSGRYVCV--------- 2324

  Fly  7208 TEYTVMNLIEMGDYEFRVFAVNSAGRSEPSLCTMPIKVCEVLGGKKPDWITRLQDKVAPFGKDYT 7272
                               |||:||:::     :..:|...:..:.|:..|.|.:........:|
 Frog  2325 -------------------AVNAAGQTD-----IKYEVFVQVPPELPNTQTELLNVSTSLHGTFT 2365

  Fly  7273 LQCAASGKPSPTARWLRNGKEIQ-------MNGGRMTCDSKDGVFRLHISNVQTGDDGDYTCEAM 7330
            :.|.|:|.|.|...|.||.:.:.       .:|||:          |.|::.|..|.|.|||...
 Frog  2366 ITCEATGIPPPVITWFRNNEALSPRENVHLQSGGRV----------LRITHAQIQDAGHYTCVVT 2420

  Fly  7331 NSLGFVNTSGYLKIGSPPIIN-RCPSELKLPEGDNSKIKIFYSG-DQPLTVILKKNNEVICDSND 7393
            |:.|......::.|..||.|: ...::|::|||.:..:....|| .:||...|:.:..|  .|.|
 Frog  2421 NTAGQAKKDFFVDILVPPSIDGEDDNDLRVPEGQSVTLSCKVSGHPKPLITWLRDSQPV--QSGD 2483

  Fly  7394 DTHVKVNIFDDYVAIYIRNIVKSDGGPYQIEFTNESGSATGEFYVHITGMPSAPTGPMGISYINK 7458
            :    |.|..|...::|::....:.|.|.....|.....:..:.|.:...|:. :||:. ...|:
 Frog  2484 E----VLISPDGSELHIQSANVFNVGHYTCIAINSIAERSRSYIVTVLVSPTI-SGPLD-DEANE 2542

  Fly  7459 NSCMLNWRPPSYDGGLKVSHYVIERK--DVSSPHWITVSSTCKDT--------AFNVQGLIENQE 7513
            :..::...|.|         .:.|..  .:.|..|:......||:        ...:|.|...:|
 Frog  2543 DVIVIVNNPFS---------LICEALGFPIPSVTWLKNGEPFKDSDNLRLLPGGHGLQILNAQEE 2598

  Fly  7514 YIFRVMAVNENGMGPPLEG------LNPIRAKDPIDPPSPPGSPQI-TEIGGDFV---------- 7561
            ...:...|..|.:|..:..      :.|:..:|  ||....|..:: |::.....          
 Frog  2599 DSGQYTCVVTNEVGEAIRNYEVKVFIPPVIKRD--DPHQDVGIKEVKTKVNSSLTLQCESQAVPK 2661

  Fly  7562 -HLEWEKP----ESDGGAHIQGYWIDKREVGSNTWQRVNATICAANQINCINLIEGRQYEFRIFA 7621
             .|.|.|.    ||.||..|..   |.:|:                |:..|.|.:..:|  ...|
 Frog  2662 PTLHWYKDGQLLESSGGVQILS---DGQEL----------------QLQPIRLSDSGRY--TCVA 2705

  Fly  7622 QNVAGLSTESSASQAVKIIDPQAASPPLIVKP----------LRD---------ANCIQNHNAQF 7667
            .|||| ..|......|::       ||:..:|          .||         ...:..:....
 Frog  2706 TNVAG-EDEKEFYVNVQV-------PPIFHRPGSPSAAFELVPRDDDEEELTEHREVVATNPISL 2762

  Fly  7668 TCTINGVPKPTISWYKGAREISNGARYHMYSEGDNHFLNINDVFGEDADEYVCRAVNKAGAKSTR 7732
            .|..|.:|.|.::|||..:.:|:.....:..||  ..|.|.....:.|.:|.|.|.|:||.....
 Frog  2763 YCDTNAIPPPILTWYKDGQLLSSSDGVLILLEG--RILQIPMAHAKHAGKYTCEATNEAGEDRLH 2825

  Fly  7733 ATLAIMTAPKLNVPPRFRDTAYFDKGE--------NVV------IKIPFTGFPKPRIHWVRDGEN 7783
            ..|.::|.|.:             |||        :|:      :....:|.|.|.|.|:|:|..
 Frog  2826 YELVVLTPPVM-------------KGEVDELIQEVSVIYNQTAELHCDASGIPPPSITWLRNGLT 2877

  Fly  7784 IESGGHYTV----EVKERHAVLIIRDGSHLDSGPYRITAENELGSDTAI--IQVQISDRPDPPRF 7842
            :.:...|.:    :..:.|:|.:    |.:||  |...|||..|....:  :.|.::        
 Frog  2878 LSTAERYQILNEGKTLQIHSVQV----SDIDS--YVCVAENPAGFAERLFTLMVHVT-------- 2928

  Fly  7843 PLIESIGTESLSLSWKAPVWDGCSDITNYYVERREHPLSSWIRVGNTRFTSMAVSGLTPGKEY-- 7905
            |:|.....|::|...::.|...|.      |:....|...|.:.|..         |||.|..  
 Frog  2929 PVISGPNPENISAVLQSSVSLVCD------VQSHPTPEIMWYKDGQL---------LTPTKGLLI 2978

  Fly  7906 ---------------DFRIFADNVYGRSDASD--TSTLIKTKESVKKKPIERKWEIDANGRKLRG 7953
                           :..|:...|:..:.:::  ...::....|:|:.|              .|
 Frog  2979 MPGGQVLQIARVQMSNQGIYMCKVHNPAGSAEKLLHLIVYVPPSIKEPP--------------NG 3029

  Fly  7954 KADGPVKDYDSYVFDIYSKFVPQPVEISQQSVYDRYDILEEIGTGAFGVVHRCRERSTGNIFAAK 8018
            |.:..|:..||......|..:|:|.                                        
 Frog  3030 KQETVVRLGDSLTLQCESDALPRPT---------------------------------------- 3054

  Fly  8019 FIPVSHSVEKDLIRREIDIMNQLHHQKLINLHDAFEDDDEMILILEFLSGGELFERITAEGYVMT 8083
                                                       |..:.:|.:|.|    .|.|..
 Frog  3055 -------------------------------------------ITWYKNGHQLLE----NGVVRI 3072

  Fly  8084 EAEVINYMRQICEGIRHMHEQNIIHLDIKPEN---IMCQTRSSTNVKLIDFGL-----ATRLDP- 8139
                            |.|.|.:..||||..:   ..|:..:......:.:.:     ||.:.| 
 Frog  3073 ----------------HDHGQRLEILDIKASDKGQYTCKVANMAGEVELTYTVIINVPATIVRPQ 3121

  Fly  8140 NEVVKITTGTAEFAAPEIVNREPVGFYTDMWATGVLSYVLLSGLSPFAGDNDVQTLKNVKACD-- 8202
            ||.:::..|.:.                      |||.......||.     |..||:.:..|  
 Frog  3122 NETIQLIIGNSI----------------------VLSCEAEGSPSPV-----VTWLKDGEPLDSG 3159

  Fly  8203 -WDFDVESFKYISEEAKDFIRKLLVRNKEKRMTAHECLLHPWLTGDHSAMKQEINRDRYLAYREK 8266
             |...:..           .|..:.|.::.....:.|:.                       :..
 Frog  3160 VWGVAIRG-----------SRLQITRVQQSHAGRYRCIA-----------------------QNS 3190

  Fly  8267 LRRKYEDFERFLLPIGRLSEYSSLRKLLMEKYKIHDAVFDRRQAAPRFV--IRPSSQFCYEGQSV 8329
            :...::||                 .||:             |.|||..  ..||.....|.|.|
 Frog  3191 ISETHKDF-----------------VLLV-------------QVAPRIFGSEMPSEHSVPEKQEV 3225

  Fly  8330 KFYCRCIAIATPTLTWSHNNIELRQSVKFMKRYVGDDYYFIINRVKLDDRGEYIIRAENHYGSRE 8394
            |..|:......|.:.|..:...|..::....|...|..:.::..|:..|.|.|...|.|:.|...
 Frog  3226 KLECKTEGTPAPQILWFKDGNPLDVTLVPNTRVFQDGNFLVLRSVQASDSGRYTCVARNNAGEDT 3290

  Fly  8395 EVVFLNVQPLPKEQPRYRTESTPVRRREPLPYTFWQEESETAPSFTFLLRPRVMQARDTCKLLCC 8459
            .|..||:...|                      .::..|..:...:.:...:|       .|.|.
 Frog  3291 RVYVLNILVPP----------------------IFESGSNASDVLSSVPGGQV-------TLECH 3326

  Fly  8460 LSGKPVPNVRWYKDGRELSKYEYAMTHSDGVVTMEIIDCKPSDSGKYSCKATNCHGTDETDCVVI 8524
            .||.....:.|:|||..||...|....|.|.: :.....:.||:|.|:|.|::..|..|.:.|:.
 Frog  3327 ASGSLPLKLSWFKDGHPLSTSRYVRIASGGRI-LRFSQVQVSDAGTYTCVASSPAGAAEKNFVLH 3390

  Fly  8525 VEGEWVTPEQAQLAHNFLYSGDRKYIEQPIKPAPLPIVT-SRQYTSSSVQNTSEPQ--GDKVNVS 8586
            :|...|..............|............|||.:: .:.....::|:...|.  |.::::.
 Frog  3391 IESLPVLERSESTEEVTAIKGASVTFTCEAHGTPLPSLSWEKDGQPLNLQSNLLPNGLGTRLHLE 3455

  Fly  8587 NSNS--SGISNKKKYASNSLQAPGSPSRSRSATKELILPPDDSLMCKPEFTKPL--HDLTIHDGE 8647
            :..:  |||     |:..::.|.|..|:....|   :|.|       |....|.  .:::|....
 Frog  3456 SVRALDSGI-----YSCIAVNAAGRVSKHFHLT---VLEP-------PRIEGPALPTEVSIIADS 3505

  Fly  8648 QLILTCYVKGDPEPQISWSKNGKSLSSSDILDLRYKNGIATLTINEVFPEDEGVITCTATNSVG- 8711
            .|.|.|...|.|.|:|||.|:|:.||..|:|.   :|| ..|.|..|..||.|:..|.||::.| 
 Frog  3506 PLELACTATGVPTPEISWEKDGRPLSHPDLLT---RNG-TVLRIERVKAEDAGIYVCVATSTAGR 3566

  Fly  8712 ---AVETKCKLTIQPLDKNINKRKVNAGDNAPKIVSHLESR--FVRDGDAVNLACRIIGAQHFDV 8771
               |...:.|:                   .|.:|...|.|  .|..|..:.|.|::.......:
 Frog  3567 DSRATWVRMKV-------------------PPSVVGSTEPRSLAVSVGGQLVLECKVEADPPPTI 3612

  Fly  8772 VWLHNNKEIKPSKDFQYTNEANIYRLQIAEIFPEDGGTYTCEAFNDIGESFSTCTINVTVPGDET 8836
            .|...:..::.....|..::...  :||..:.|.|.|.|||.|.|..|.:....|:.:.:     
 Frog  3613 QWYRGDIPLQTDGRVQVLSKGRY--VQIHSLRPSDSGEYTCIASNPAGRTSLHFTVEIQL----- 3670

  Fly  8837 KQPSFVKFPTSVSVLEGEGTTFECEIDSELLNLV-WLKDGKPIDETLPRYSFTKDGHRYSFAVAK 8900
             .|.....|:.|||...:.....|.::...|.:. |.|||.|:...:.|..|..||   |..:.:
 Frog  3671 -APMIQPGPSVVSVSVNQTAVLPCRMEGIPLPVASWRKDGSPLSVEISRMEFLADG---SLRIPQ 3731

  Fly  8901 CNMDDVGQY 8909
            ..:.|.|.|
 Frog  3732 ALLQDSGYY 3740

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btNP_001162825.1 I-set 9..101 CDD:254352
Ig 26..100 CDD:143165
I-set 119..210 CDD:254352
Ig 136..209 CDD:143165
I-set 228..320 CDD:254352
IGc2 242..312 CDD:197706
I-set 335..425 CDD:254352
Ig 350..423 CDD:143165
Ig 436..530 CDD:299845
I-set 438..532 CDD:254352
I-set 545..636 CDD:254352
Ig 560..633 CDD:143165
Ig 657..731 CDD:143165
I-set 746..835 CDD:254352
Ig 1496..1586 CDD:299845
IG_like 1503..1588 CDD:214653
I-set 1639..1724 CDD:254352
IG 1750..1821 CDD:214652
IGc2 1750..1806 CDD:197706
I-set 1826..1909 CDD:254352
Ig 1831..1897 CDD:299845
I-set 1914..1998 CDD:254352
Ig 2020..2095 CDD:299845
FN3 2100..2194 CDD:238020
FN3 2203..2292 CDD:238020
I-set 2311..2395 CDD:254352
Ig 2321..2395 CDD:299845
FN3 2399..2493 CDD:238020
FN3 2501..2590 CDD:238020
I-set 2602..2693 CDD:254352
Ig 2619..2693 CDD:299845
FN3 2697..2793 CDD:238020
FN3 2801..2893 CDD:238020
I-set 2902..2995 CDD:254352
Ig 2919..2993 CDD:299845
FN3 2999..3088 CDD:238020
FN3 3102..3191 CDD:238020
I-set 3208..3292 CDD:254352
Ig 3219..3292 CDD:299845
FN3 3296..3390 CDD:238020
FN3 3400..3489 CDD:238020
I-set 3494..3590 CDD:254352
Ig 3516..3590 CDD:299845
FN3 3594..3682 CDD:238020
FN3 3694..3781 CDD:238020
I-set 3795..3885 CDD:254352
Ig 3813..3885 CDD:299845
FN3 3889..3980 CDD:238020
FN3 3990..4082 CDD:238020
I-set 4090..4181 CDD:254352
Ig 4108..4181 CDD:299845
FN3 4185..4271 CDD:238020
FN3 4285..4383 CDD:238020
Ig 4404..4480 CDD:299845 1/2 (50%)
FN3 4484..4571 CDD:238020 19/95 (20%)
FN3 4584..4677 CDD:238020 23/93 (25%)
I-set 4685..4775 CDD:254352 17/99 (17%)
Ig 4703..4775 CDD:299845 14/81 (17%)
FN3 4779..4863 CDD:238020 21/95 (22%)
FN3 4879..4970 CDD:238020 19/112 (17%)
IG 4989..5069 CDD:214652 24/79 (30%)
Ig 4996..5069 CDD:299845 23/72 (32%)
FN3 5073..5166 CDD:238020 13/92 (14%)
FN3 5175..5265 CDD:238020 17/89 (19%)
I-set 5276..5366 CDD:254352 13/90 (14%)
Ig 5293..5366 CDD:299845 7/72 (10%)
FN3 5370..5462 CDD:238020 10/91 (11%)
FN3 5470..5561 CDD:238020 9/90 (10%)
Ig 5559..5654 CDD:299845 25/101 (25%)
I-set 5570..5660 CDD:254352 24/96 (25%)
FN3 5664..5755 CDD:238020 26/115 (23%)
FN3 5764..5853 CDD:238020 16/90 (18%)
I-set 5865..5954 CDD:254352 20/88 (23%)
Ig 5882..5954 CDD:299845 18/71 (25%)
FN3 5958..6049 CDD:238020 14/90 (16%)
FN3 6062..6153 CDD:238020 16/90 (18%)
I-set 6173..6255 CDD:254352 25/82 (30%)
Ig_Titin_like 6182..6255 CDD:143225 21/73 (29%)
FN3 6259..6350 CDD:238020 18/93 (19%)
FN3 6359..6451 CDD:238020 26/120 (22%)
FN3 6470..6552 CDD:238020 16/83 (19%)
I-set 6564..6650 CDD:254352 18/88 (20%)
Ig_Titin_like 6577..6650 CDD:143225 15/72 (21%)
FN3 6654..6745 CDD:238020 17/114 (15%)
FN3 6754..6840 CDD:238020 15/85 (18%)
I-set 6855..6946 CDD:254352 20/99 (20%)
Ig 6874..6946 CDD:299845 16/80 (20%)
FN3 6950..7042 CDD:238020 22/108 (20%)
FN3 7050..7139 CDD:238020 25/103 (24%)
FN3 7151..7237 CDD:238020 18/93 (19%)
I-set 7254..7334 CDD:254352 24/86 (28%)
Ig 7272..7339 CDD:143165 22/73 (30%)
IG_like 7354..7440 CDD:214653 20/86 (23%)
Ig 7366..7440 CDD:299845 16/74 (22%)
FN3 7444..7531 CDD:238020 17/96 (18%)
FN3 7545..7637 CDD:238020 22/107 (21%)
I-set 7648..7737 CDD:254352 24/107 (22%)
Ig 7665..7734 CDD:143165 19/68 (28%)
Ig 7760..7833 CDD:299845 20/84 (24%)
FN3 7837..7927 CDD:238020 16/108 (15%)
STKc_Twitchin_like 7986..8244 CDD:271016 33/269 (12%)
S_TKc 7989..8244 CDD:214567 33/266 (12%)
Ig 8311..8394 CDD:299845 22/84 (26%)
I-set 8312..8401 CDD:254352 23/90 (26%)
I-set 8437..8525 CDD:254352 23/87 (26%)
Ig 8455..8519 CDD:143165 20/63 (32%)
I-set 8632..8721 CDD:254352 32/94 (34%)
IGc2 8646..8711 CDD:197706 26/64 (41%)
I-set 8740..8831 CDD:254352 22/92 (24%)
Ig 8757..8826 CDD:143165 15/68 (22%)
I-set 8839..8922 CDD:254352 20/72 (28%)
Ig 8845..>8909 CDD:299845 18/64 (28%)
hmcn2XP_031747766.1 vWFA 29..165 CDD:238119
IG_like 434..503 CDD:214653 18/112 (16%)
Ig strand B 434..438 CDD:409353 0/3 (0%)
Ig strand C 447..451 CDD:409353 0/3 (0%)
Ig strand E 469..473 CDD:409353 1/3 (33%)
Ig strand F 483..488 CDD:409353 0/4 (0%)
Ig 514..592 CDD:416386 15/88 (17%)
Ig strand A' 515..518 CDD:409353 0/2 (0%)
Ig strand B 524..531 CDD:409353 3/6 (50%)
Ig strand C 537..542 CDD:409353 0/4 (0%)
Ig strand C' 544..546 CDD:409353 0/1 (0%)
Ig strand D 551..555 CDD:409353 0/3 (0%)
Ig strand E 558..563 CDD:409353 0/4 (0%)
Ig strand F 571..579 CDD:409353 2/12 (17%)
Ig strand G 582..592 CDD:409353 2/15 (13%)
I-set 596..681 CDD:400151 28/89 (31%)
Ig strand B 613..617 CDD:409353 1/3 (33%)
Ig strand C 626..630 CDD:409353 2/5 (40%)
Ig strand E 648..652 CDD:409353 1/3 (33%)
Ig strand F 662..667 CDD:409353 1/4 (25%)
Ig strand G 676..679 CDD:409353 0/2 (0%)
Ig 695..770 CDD:416386 27/174 (16%)
Ig strand B 703..707 CDD:409353 0/10 (0%)
Ig strand C 716..720 CDD:409353 1/22 (5%)
Ig strand E 736..740 CDD:409353 1/20 (5%)
Ig strand F 750..755 CDD:409353 2/8 (25%)
Ig strand G 763..766 CDD:409353 2/2 (100%)
Ig strand A 774..778 CDD:409353 1/3 (33%)
IG_like 780..864 CDD:214653 27/275 (10%)
Ig strand A' 781..786 CDD:409353 1/4 (25%)
Ig strand B 790..798 CDD:409353 0/7 (0%)
Ig strand C 804..809 CDD:409353 1/33 (3%)
Ig strand C' 812..815 CDD:409353 1/26 (4%)
Ig strand D 822..825 CDD:409353 1/9 (11%)
Ig strand F 843..851 CDD:409353 3/95 (3%)
I-set 870..957 CDD:400151 25/101 (25%)
Ig strand A' 878..881 CDD:409353 0/2 (0%)
Ig strand B 887..895 CDD:409353 3/9 (33%)
Ig strand C 901..906 CDD:409353 1/4 (25%)
Ig strand C' 909..911 CDD:409353 0/1 (0%)
Ig strand D 917..921 CDD:409353 0/3 (0%)
Ig strand E 923..927 CDD:409353 2/10 (20%)
Ig strand F 936..944 CDD:409353 2/7 (29%)
Ig strand G 947..957 CDD:409353 3/9 (33%)
I-set 961..1048 CDD:400151 19/88 (22%)
Ig strand A' 969..973 CDD:409353 0/5 (0%)
Ig strand B 977..984 CDD:409353 1/6 (17%)
Ig strand C 991..996 CDD:409353 2/4 (50%)
Ig strand C' 998..1001 CDD:409353 1/2 (50%)
Ig strand D 1007..1011 CDD:409353 2/3 (67%)
Ig strand E 1014..1020 CDD:409353 0/5 (0%)
Ig strand F 1027..1035 CDD:409353 2/7 (29%)
Ig strand G 1038..1048 CDD:409353 2/9 (22%)
Ig 1065..1146 CDD:416386 19/106 (18%)
Ig strand A' 1067..1070 CDD:409353 0/2 (0%)
Ig strand B 1076..1083 CDD:409353 2/6 (33%)
Ig strand C 1089..1094 CDD:409353 1/4 (25%)
Ig strand C' 1096..1098 CDD:409353 0/1 (0%)
Ig strand D 1105..1109 CDD:409353 0/3 (0%)
Ig strand E 1112..1117 CDD:409353 1/15 (7%)
Ig strand F 1125..1133 CDD:409353 1/7 (14%)
Ig strand G 1136..1146 CDD:409353 1/9 (11%)
Ig 1157..1237 CDD:416386 19/81 (23%)
Ig strand B 1167..1174 CDD:409353 0/6 (0%)
Ig strand C 1180..1185 CDD:409353 1/4 (25%)
Ig strand C' 1187..1189 CDD:409353 0/1 (0%)
Ig strand D 1196..1200 CDD:409353 0/5 (0%)
Ig strand E 1203..1208 CDD:409353 0/4 (0%)
Ig strand F 1216..1224 CDD:409353 2/7 (29%)
Ig strand G 1227..1237 CDD:409353 4/9 (44%)
Ig 1241..1329 CDD:416386 31/194 (16%)
Ig strand A 1241..1244 CDD:409353 1/9 (11%)
Ig strand A' 1250..1253 CDD:409353 2/2 (100%)
Ig strand B 1259..1266 CDD:409353 0/6 (0%)
Ig strand C 1272..1277 CDD:409353 1/7 (14%)
Ig strand C' 1280..1282 CDD:409353 0/1 (0%)
Ig strand D 1289..1293 CDD:409353 1/20 (5%)
Ig strand E 1295..1299 CDD:409353 2/3 (67%)
Ig strand F 1308..1316 CDD:409353 2/7 (29%)
Ig strand G 1319..1329 CDD:409353 1/9 (11%)
I-set 1342..1420 CDD:400151 25/80 (31%)
Ig strand A' 1343..1346 CDD:409353 1/2 (50%)
Ig strand B 1352..1359 CDD:409353 1/6 (17%)
Ig strand C 1365..1370 CDD:409353 2/4 (50%)
Ig strand C' 1373..1375 CDD:409353 0/1 (0%)
Ig strand D 1381..1385 CDD:409353 1/3 (33%)
Ig strand E 1387..1392 CDD:409353 0/4 (0%)
Ig strand F 1401..1409 CDD:409353 4/7 (57%)
Ig strand G 1412..1420 CDD:409353 1/7 (14%)
I-set 1434..1516 CDD:400151 20/105 (19%)
Ig strand A' 1436..1439 CDD:409353 0/2 (0%)
Ig strand B 1445..1452 CDD:409353 2/12 (17%)
Ig strand C 1458..1463 CDD:409353 1/4 (25%)
Ig strand C' 1465..1467 CDD:409353 0/1 (0%)
Ig strand D 1474..1478 CDD:409353 0/3 (0%)
Ig strand E 1481..1487 CDD:409353 0/11 (0%)
Ig strand F 1495..1503 CDD:409353 3/10 (30%)
I-set 1538..1609 CDD:400151 22/85 (26%)
Ig strand B 1539..1546 CDD:409353 2/6 (33%)
Ig strand C 1552..1557 CDD:409353 2/4 (50%)
Ig strand C' 1559..1561 CDD:409353 0/4 (0%)
Ig strand D 1567..1571 CDD:409353 0/3 (0%)
Ig strand E 1574..1580 CDD:409353 1/5 (20%)
Ig strand F 1588..1596 CDD:409353 1/7 (14%)
Ig strand G 1599..1609 CDD:409353 6/21 (29%)
Ig 1621..1703 CDD:416386 20/110 (18%)
Ig strand A' 1624..1628 CDD:409353 2/3 (67%)
Ig strand B 1632..1639 CDD:409353 0/6 (0%)
Ig strand C 1646..1651 CDD:409353 0/4 (0%)
Ig strand C' 1653..1656 CDD:409353 1/2 (50%)
Ig strand D 1661..1665 CDD:409353 1/13 (8%)
Ig strand E 1668..1675 CDD:409353 2/7 (29%)
Ig strand F 1682..1690 CDD:409353 3/7 (43%)
I-set 1717..1796 CDD:400151 17/82 (21%)
Ig strand C 1739..1743 CDD:409353 0/3 (0%)
Ig strand E 1762..1766 CDD:409353 0/3 (0%)
Ig strand F 1776..1781 CDD:409353 1/4 (25%)
Ig 1796..1880 CDD:416386 17/103 (17%)
Ig strand A' 1801..1804 CDD:409353 1/2 (50%)
Ig strand B 1818..1825 CDD:409353 0/6 (0%)
Ig strand C 1831..1836 CDD:409353 3/4 (75%)
Ig strand C' 1838..1840 CDD:409353 0/1 (0%)
Ig strand F 1859..1867 CDD:409353 1/7 (14%)
Ig strand G 1870..1880 CDD:409353 1/9 (11%)
I-set 1886..1964 CDD:400151 19/107 (18%)
Ig strand A' 1892..1895 CDD:409353 0/2 (0%)
Ig strand B 1901..1908 CDD:409353 0/6 (0%)
Ig strand C 1914..1919 CDD:409353 1/4 (25%)
Ig strand C' 1920..1922 CDD:409353 1/1 (100%)
Ig strand D 1929..1933 CDD:409353 0/3 (0%)
Ig strand E 1936..1942 CDD:409353 1/5 (20%)
Ig strand F 1950..1958 CDD:409353 3/19 (16%)
Ig 1984..2063 CDD:416386 17/90 (19%)
Ig strand B 1992..1999 CDD:409353 0/6 (0%)
Ig strand C 2005..2010 CDD:409353 1/4 (25%)
Ig strand C' 2012..2014 CDD:409353 0/1 (0%)
Ig strand D 2022..2025 CDD:409353 1/2 (50%)
Ig strand E 2029..2035 CDD:409353 3/15 (20%)
Ig strand F 2042..2049 CDD:409353 2/6 (33%)
Ig strand G 2055..2063 CDD:409353 3/9 (33%)
Ig_3 2066..2141 CDD:404760 15/91 (16%)
Ig strand B 2084..2088 CDD:409353 1/3 (33%)
Ig strand C 2097..2101 CDD:409353 2/17 (12%)
Ig strand E 2120..2124 CDD:409353 0/3 (0%)
Ig strand F 2134..2139 CDD:409353 0/4 (0%)
Ig strand A 2158..2161 CDD:409353 0/2 (0%)
Ig strand A' 2167..2170 CDD:409353 1/2 (50%)
Ig 2170..2246 CDD:416386 21/90 (23%)
Ig strand B 2176..2183 CDD:409353 0/6 (0%)
Ig strand C 2189..2194 CDD:409353 3/4 (75%)
Ig strand C' 2197..2199 CDD:409353 0/1 (0%)
Ig strand E 2204..2216 CDD:409353 3/11 (27%)
Ig strand F 2225..2233 CDD:409353 2/13 (15%)
Ig strand G 2236..2246 CDD:409353 3/11 (27%)
I-set 2259..2340 CDD:400151 23/120 (19%)
Ig strand B 2270..2274 CDD:409353 0/3 (0%)
Ig strand C 2283..2287 CDD:409353 2/3 (67%)
Ig strand E 2306..2310 CDD:409353 0/3 (0%)
Ig strand F 2320..2325 CDD:409353 2/32 (6%)
Ig_3 2343..2421 CDD:404760 23/87 (26%)
Ig strand B 2364..2368 CDD:409353 1/3 (33%)
Ig strand C 2377..2381 CDD:409353 0/3 (0%)
Ig strand E 2400..2404 CDD:409353 2/13 (15%)
Ig strand F 2414..2419 CDD:409353 3/4 (75%)
Ig strand A 2437..2440 CDD:409353 2/2 (100%)
I-set 2447..2526 CDD:400151 20/84 (24%)
Ig strand A' 2447..2450 CDD:409353 1/2 (50%)
Ig strand B 2455..2463 CDD:409353 0/7 (0%)
Ig strand C 2469..2473 CDD:409353 1/3 (33%)
Ig strand C' 2476..2479 CDD:409353 0/2 (0%)
Ig strand D 2484..2488 CDD:409353 1/7 (14%)
Ig strand E 2492..2497 CDD:409353 0/4 (0%)
Ig strand F 2505..2513 CDD:409353 2/7 (29%)
Ig strand G 2516..2526 CDD:409353 1/9 (11%)
I-set 2530..2622 CDD:400151 17/102 (17%)
Ig strand B 2552..2556 CDD:409353 1/12 (8%)
Ig strand C 2565..2569 CDD:409353 1/3 (33%)
Ig strand E 2588..2592 CDD:409353 0/3 (0%)
Ig strand F 2602..2607 CDD:409353 0/4 (0%)
I-set 2633..2720 CDD:400151 23/108 (21%)
Ig strand B 2650..2654 CDD:409353 0/3 (0%)
Ig strand C 2663..2667 CDD:409353 1/3 (33%)
Ig strand E 2686..2690 CDD:409353 1/19 (5%)
Ig strand F 2700..2705 CDD:409353 1/6 (17%)
Ig 2760..2830 CDD:416386 20/71 (28%)
Ig strand B 2760..2764 CDD:409353 0/3 (0%)
Ig strand C 2773..2777 CDD:409353 0/3 (0%)
Ig strand E 2797..2800 CDD:409353 1/2 (50%)
Ig strand F 2810..2815 CDD:409353 2/4 (50%)
I-set 2839..2925 CDD:400151 20/91 (22%)
Ig strand A' 2845..2850 CDD:409353 0/4 (0%)
Ig strand B 2855..2863 CDD:409353 0/7 (0%)
Ig strand C 2867..2873 CDD:409353 3/5 (60%)
Ig strand C' 2875..2877 CDD:409353 1/1 (100%)
Ig strand D 2883..2889 CDD:409353 1/5 (20%)
Ig strand E 2890..2896 CDD:409353 0/5 (0%)
Ig strand F 2905..2912 CDD:409353 3/8 (38%)
Ig strand G 2915..2923 CDD:409353 1/7 (14%)
I-set 2929..3017 CDD:400151 16/102 (16%)
Ig strand A 2929..2932 CDD:409353 1/2 (50%)
Ig strand A' 2936..2941 CDD:409353 1/4 (25%)
Ig strand B 2947..2954 CDD:409353 2/12 (17%)
Ig strand C 2960..2965 CDD:409353 1/4 (25%)
Ig strand D 2976..2979 CDD:409353 0/2 (0%)
Ig strand E 2983..2989 CDD:409353 0/5 (0%)
Ig strand F 2996..3003 CDD:409353 1/6 (17%)
Ig strand G 3009..3017 CDD:409353 0/7 (0%)
Ig strand A 3020..3029 CDD:409353 3/22 (14%)
I-set 3034..3111 CDD:400151 20/179 (11%)
Ig strand B 3039..3049 CDD:409353 3/9 (33%)
Ig strand C 3053..3059 CDD:409353 2/88 (2%)
Ig strand C' 3061..3064 CDD:409353 1/2 (50%)
Ig strand E 3077..3083 CDD:409353 1/5 (20%)
Ig strand F 3089..3098 CDD:409353 1/8 (13%)
Ig_3 3116..3189 CDD:404760 18/133 (14%)
Ig strand A 3119..3122 CDD:409353 1/2 (50%)
Ig strand A' 3124..3128 CDD:409353 0/3 (0%)
Ig strand B 3132..3139 CDD:409353 3/28 (11%)
Ig strand C 3146..3151 CDD:409353 1/9 (11%)
Ig strand C' 3153..3156 CDD:409353 0/2 (0%)
Ig strand D 3162..3166 CDD:409353 0/3 (0%)
Ig strand E 3168..3174 CDD:409353 1/5 (20%)
Ig strand F 3181..3189 CDD:409353 1/30 (3%)
Ig_3 3206..3284 CDD:404760 19/77 (25%)
Ig strand B 3225..3229 CDD:409353 2/3 (67%)
Ig strand C 3238..3242 CDD:409353 0/3 (0%)
Ig strand E 3263..3267 CDD:409353 0/3 (0%)
Ig strand F 3277..3282 CDD:409353 1/4 (25%)
Ig strand G 3291..3294 CDD:409353 1/2 (50%)
I-set 3318..3391 CDD:400151 23/80 (29%)
Ig strand B 3321..3325 CDD:409353 2/10 (20%)
Ig strand C 3334..3338 CDD:409353 0/3 (0%)
Ig strand E 3357..3361 CDD:409353 0/4 (0%)
Ig strand F 3371..3376 CDD:409353 2/4 (50%)
Ig strand A 3395..3398 CDD:409353 1/2 (50%)
Ig strand A' 3403..3408 CDD:409353 0/4 (0%)
I-set 3406..3484 CDD:400151 15/85 (18%)
Ig strand B 3414..3421 CDD:409353 0/6 (0%)
Ig strand C 3427..3432 CDD:409353 0/4 (0%)
Ig strand D 3443..3446 CDD:409353 0/2 (0%)
Ig strand E 3450..3456 CDD:409353 0/5 (0%)
Ig strand F 3463..3470 CDD:409353 3/11 (27%)
Ig strand G 3476..3484 CDD:409353 2/10 (20%)
Ig_3 3487..3561 CDD:404760 28/84 (33%)
Ig strand A' 3498..3501 CDD:409353 0/2 (0%)
Ig strand B 3507..3514 CDD:409353 3/6 (50%)
Ig strand C 3520..3525 CDD:409353 3/4 (75%)
Ig strand C' 3527..3529 CDD:409353 1/1 (100%)
Ig strand D 3534..3538 CDD:409353 2/6 (33%)
Ig strand E 3541..3546 CDD:409353 1/4 (25%)
Ig strand F 3554..3562 CDD:409353 3/7 (43%)
I-set 3585..3668 CDD:400151 20/84 (24%)
Ig strand A' 3589..3592 CDD:409353 0/2 (0%)
Ig strand B 3598..3605 CDD:409353 2/6 (33%)
Ig strand C 3611..3616 CDD:409353 1/4 (25%)
Ig strand C' 3618..3620 CDD:409353 0/1 (0%)
Ig strand D 3626..3630 CDD:409353 1/3 (33%)
Ig strand E 3633..3639 CDD:409353 1/7 (14%)
Ig strand F 3647..3655 CDD:409353 5/7 (71%)
Ig strand G 3658..3668 CDD:409353 2/9 (22%)
I-set 3672..3759 CDD:400151 20/72 (28%)
Ig strand A 3673..3676 CDD:409353 0/2 (0%)
Ig strand A' 3680..3683 CDD:409353 1/2 (50%)
Ig strand B 3689..3696 CDD:409353 1/6 (17%)
Ig strand C 3702..3707 CDD:409353 1/4 (25%)
Ig strand C' 3709..3711 CDD:409353 1/1 (100%)
Ig strand D 3718..3722 CDD:409353 1/3 (33%)
Ig strand E 3725..3730 CDD:409353 2/7 (29%)
Ig strand F 3738..3746 CDD:409353 2/3 (67%)
TSP1 3766..3817 CDD:214559
TSP1 3822..3873 CDD:214559
nidG2 3876..4057 CDD:412205
EGF_CA 4111..4149 CDD:214542
EGF_CA 4151..4194 CDD:311536
EGF_CA 4196..4233 CDD:214542
EGF_CA 4234..4267 CDD:214542
EGF_CA 4276..4317 CDD:311536
EGF_CA 4319..4358 CDD:311536
EGF_CA 4424..4463 CDD:214542
EGF_CA 4464..4504 CDD:214542
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.