DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bt and nrg2b

DIOPT Version :10

Sequence 1:NP_001162825.1 Gene:bt / 43814 FlyBaseID:FBgn0005666 Length:8933 Species:Drosophila melanogaster
Sequence 2:XP_005157176.2 Gene:nrg2b / 100270726 ZFINID:ZDB-GENE-090205-2 Length:705 Species:Danio rerio


Alignment Length:765 Identity:135/765 - (17%)
Similarity:223/765 - (29%) Gaps:301/765 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly  7235 EPSLCTMPIKVCEVLGGKKP---DWITRLQDKVAPFGKDYTLQCAASGKPSPTARWLRNGKEI-Q 7295
            |..||    |.|......||   .|   ||:     ||..||:|.|.|.|||:..|.::|.:: |
Zfish   130 ESVLC----KDCASAPKVKPMDSQW---LQE-----GKKLTLKCEAVGNPSPSFNWYKDGSQLRQ 182

  Fly  7296 MNGGRMTCDSKDGVFRLHISNVQTGDDGDYTCEAMNSLGFVNTSGYLKIGSPPIINRCPSELKLP 7360
            ....::..:.|:.  :||||.|:..|.|:|||...||||..|.:.::.:                
Zfish   183 KKTVKIKTNKKNS--KLHISKVRLEDSGNYTCVVENSLGRENATSFVSV---------------- 229

  Fly  7361 EGDNSKIKIFYSGDQPLTVILKKNNEVI--CDSNDDTHVKVNIFDDYVAIYIRNIVKSDGGPYQI 7423
                          |.:|..|...:...  |:..:.|:. :|..|.|   :|..|       .|:
Zfish   230 --------------QSITTTLSPGSSHARKCNETEKTYC-INGGDCY---FIHGI-------NQL 269

  Fly  7424 ------EFTNE--SGSATGEFYVHITGMPSAPTGPMGISYINKNSCMLNWRPPSYDGGLKVSHYV 7480
                  ::|.|  ..|....||.|           :||.                         :
Zfish   270 SCKCPNDYTGERCQTSVMAGFYKH-----------LGIE-------------------------I 298

  Fly  7481 IERKDVSSPHWITVSSTCKDTAFNVQGLI-------------ENQEYIFRVMAVNENGMGPPLEG 7532
            :|.:::.....:|::..|  .|..|.|::             :...::.:.|..         |.
Zfish   299 MEAEELYQKRVLTITGIC--VALLVVGIVCVVAYCKTKKQRKKMHNHLHQNMCA---------EH 352

  Fly  7533 LNPIRAKDPIDP-PSPPGSPQITEIGGDFVHLEWEKPESDGGAHIQGYWIDKREVGSNTWQRVNA 7596
            .|.:.|..|..| |.|...|.:     |::.                             :.|.|
Zfish   353 PNRMLANGPNHPGPGPEEIPMV-----DYIS-----------------------------KNVPA 383

  Fly  7597 TICAANQINCINLIEGRQYEFRIFAQNVAGLSTESSASQAVKIIDPQAASPPLIVKPLRDANCIQ 7661
            |                        :.|....||:|.:                           
Zfish   384 T------------------------ERVVRHGTETSGN--------------------------- 397

  Fly  7662 NHNAQFTCTINGVPKPTISWYKGAREISNGARYHMYSEGDNH-------FLNINDVFGEDADEYV 7719
                                :.|:|..|........|...:|       .:...|....|.    
Zfish   398 --------------------FSGSRMSSRSHHTSTASHTSSHRHEERTWSMERTDSIHSDC---- 438

  Fly  7720 CRAVNKAGAKSTRATLAIMTAPKLNVPPRFRDTAYFDKGENVVIKIPFTGFPKPRIHWVRDGENI 7784
                 ::||.|:....:..::|.. :..|.|..||             .|:|......::.|::.
Zfish   439 -----QSGALSSSVGTSKCSSPAC-MEARARRAAY-------------CGYPDATQCSLQYGDSY 484

  Fly  7785 ESGGHYTVEVKERHAVLIIRDGSHLDSGPYRITAENELGSDTAIIQVQISDRPDPPRFPLIESIG 7849
            :|                :||..|.|.....:|....|..    :....|..|..|.|.:.....
Zfish   485 DS----------------LRDSPHSDRYVSALTTPARLSP----VDFHSSLPPQVPTFQITTPNA 529

  Fly  7850 TESLSLSWKAPVWDGCSDITNYYVERREHPLSSWIRVGNTRFTSMAVSGLTPGKEYDFRIFADNV 7914
            :.:|||...|......:     |....:.||....|.....:.:...:|..|...|.   |.|: 
Zfish   530 SHALSLPPAASAIAMAA-----YSPDDDQPLLYRYRRSRRPYYAAESTGSLPSSPYR---FVDD- 585

  Fly  7915 YGRSDASDTSTLIKTKESVKKKPIERKWEIDANGRKLRGKADGPVKDYDS 7964
               .|...|...:.::|..||....|:|.   ...::.|...|| ::|.|
Zfish   586 ---EDYETTQEYMSSREQPKKSSGSRRWR---RRSRINGHTPGP-RNYSS 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btNP_001162825.1 Ig 9..101 CDD:472250
Ig strand B 26..30 CDD:409353
Ig strand C 39..43 CDD:409353
Ig strand E 69..73 CDD:409353
Ig strand F 83..88 CDD:409353
Ig strand G 96..99 CDD:409353
I-set 119..210 CDD:400151
Ig strand B 136..140 CDD:409353
Ig strand C 149..153 CDD:409353
Ig strand E 174..182 CDD:409353
Ig strand F 192..197 CDD:409353
Ig strand G 205..208 CDD:409353
Ig 228..320 CDD:472250
Ig strand B 245..249 CDD:409353
Ig strand C 258..262 CDD:409353
Ig strand E 286..292 CDD:409353
Ig strand F 302..307 CDD:409353
Ig strand G 317..320 CDD:409353
Ig 335..425 CDD:472250
Ig strand B 350..354 CDD:409353
Ig strand C 363..367 CDD:409353
Ig strand E 393..397 CDD:409353
Ig strand F 407..412 CDD:409353
Ig strand G 420..423 CDD:409353
Ig 438..532 CDD:472250
Ig strand B 455..459 CDD:409353
Ig strand C 468..472 CDD:409353
Ig strand E 498..502 CDD:409353
Ig strand F 512..517 CDD:409353
Ig strand G 525..528 CDD:409353
Ig 545..636 CDD:472250
Ig strand B 560..564 CDD:409353
Ig strand C 573..577 CDD:409353
Ig strand E 599..606 CDD:409353
Ig strand F 616..621 CDD:409353
Ig strand G 629..632 CDD:409353
Ig 656..726 CDD:472250
Ig strand B 657..661 CDD:409353
Ig strand C 670..674 CDD:409353
Ig strand E 700..704 CDD:409353
Ig strand F 714..719 CDD:409353
Ig strand G 728..731 CDD:409353
Ig 746..835 CDD:472250
Ig strand C 777..781 CDD:409353
Ig strand E 802..806 CDD:409353
Ig strand F 816..821 CDD:409353
Ig 1508..1588 CDD:472250
Ig strand B 1514..1518 CDD:409353
Ig strand C 1527..1531 CDD:409353
Ig strand E 1554..1558 CDD:409353
Ig strand F 1568..1573 CDD:409353
Ig strand G 1581..1584 CDD:409353
Ig 1639..1724 CDD:472250
IG_like 1750..1821 CDD:214653
Ig strand B 1750..1753 CDD:409353
Ig strand C 1761..1765 CDD:409353
Ig strand E 1788..1792 CDD:409353
Ig strand F 1802..1806 CDD:409353
Ig 1826..1909 CDD:472250
Ig strand B 1842..1846 CDD:409353
Ig strand C 1854..1858 CDD:409353
Ig strand E 1879..1883 CDD:409353
Ig 1914..1998 CDD:472250
Ig 2020..2095 CDD:472250
Ig strand B 2021..2025 CDD:409353
Ig strand C 2038..2042 CDD:409353
Ig strand E 2062..2066 CDD:409353
Ig strand F 2076..2081 CDD:409353
Ig strand G 2089..2092 CDD:409353
FN3 2100..2194 CDD:238020
FN3 2203..2292 CDD:238020
Ig 2314..2395 CDD:472250
Ig strand B 2322..2326 CDD:409353
Ig strand C 2335..2339 CDD:409353
Ig strand E 2361..2365 CDD:409353
Ig strand F 2375..2380 CDD:409353
FN3 <2376..2753 CDD:442628
Ig strand G 2388..2391 CDD:409353
FN3 2501..2590 CDD:238020
FN3 <2673..>2891 CDD:442628
Ig 2902..2995 CDD:472250
Ig strand B 2920..2924 CDD:409353
Ig strand C 2933..2937 CDD:409353
FN3 <2957..>3191 CDD:442628
Ig strand E 2961..2965 CDD:409353
Ig strand F 2975..2980 CDD:409353
Ig strand G 2988..2991 CDD:409353
FN3 2999..3088 CDD:238020
Ig 3212..3292 CDD:472250
Ig strand B 3220..3224 CDD:409353
Ig strand C 3233..3237 CDD:409353
Ig strand E 3258..3262 CDD:409353
Ig strand F 3272..3277 CDD:409353
Ig strand G 3285..3288 CDD:409353
FN3 3296..3390 CDD:238020
FN3 3400..3489 CDD:238020
I-set 3494..3590 CDD:400151
Ig strand B 3517..3521 CDD:409353
Ig strand C 3530..3534 CDD:409353
Ig strand E 3556..3560 CDD:409353
Ig strand F 3570..3575 CDD:409353
Ig strand G 3583..3586 CDD:409353
FN3 3594..3682 CDD:238020
FN3 3694..3781 CDD:238020
I-set 3795..3885 CDD:400151
Ig strand B 3813..3817 CDD:409353
Ig strand C 3826..3830 CDD:409353
Ig strand E 3851..3855 CDD:409353
Ig strand F 3865..3870 CDD:409353
FN3 <3866..4181 CDD:442628
Ig strand G 3878..3881 CDD:409353
FN3 4185..4271 CDD:238020
FN3 4285..4383 CDD:238020
FN3 4356..4776 CDD:442628
FN3 4779..4863 CDD:238020
FN3 4879..4970 CDD:238020
Ig_3 4978..5056 CDD:464046
FN3 <5021..>5264 CDD:442628
FN3 5073..5166 CDD:238020
Ig 5286..5366 CDD:472250
Ig strand B 5294..5298 CDD:409353
Ig strand C 5307..5311 CDD:409353
Ig strand E 5332..5336 CDD:409353
Ig strand F 5346..5351 CDD:409353
Ig strand G 5359..5362 CDD:409353
FN3 5370..5462 CDD:238020
FN3 5470..5561 CDD:238020
Ig 5559..5654 CDD:472250
Ig strand B 5588..5592 CDD:409353
Ig strand C 5601..5605 CDD:409353
Ig strand E 5626..5630 CDD:409353
Ig strand F 5640..5645 CDD:409353
FN3 5664..5755 CDD:238020
FN3 5764..5853 CDD:238020
Ig 5874..5954 CDD:472250
Ig strand B 5882..5886 CDD:409353
Ig strand C 5895..5899 CDD:409353
Ig strand E 5920..5924 CDD:409353
Ig strand F 5934..5939 CDD:409353
Ig strand G 5947..5950 CDD:409353
FN3 <5972..>6384 CDD:442628
Ig_Titin_like 6174..6255 CDD:409406
Ig strand A 6174..6178 CDD:409406
Ig strand B 6183..6189 CDD:409406
Ig strand C 6195..6201 CDD:409406
Ig strand D 6213..6218 CDD:409406
Ig strand E 6219..6225 CDD:409406
Ig strand F 6234..6242 CDD:409406
FN3 <6236..6552 CDD:442628
Ig strand G 6245..6255 CDD:409406
Ig_Titin_like 6570..6650 CDD:409406
Ig strand A 6570..6573 CDD:409406
Ig strand B 6578..6584 CDD:409406
Ig strand C 6590..6596 CDD:409406
Ig strand D 6608..6613 CDD:409406
Ig strand E 6614..6620 CDD:409406
Ig strand F 6629..6637 CDD:409406
FN3 <6630..7006 CDD:442628
Ig strand G 6640..6650 CDD:409406
FN3 <6905..>7189 CDD:442628
FN3 7151..7237 CDD:238020 1/1 (100%)
Ig 7254..7344 CDD:472250 33/93 (35%)
Ig strand B 7271..7275 CDD:409353 2/3 (67%)
Ig strand C 7284..7288 CDD:409353 0/3 (0%)
Ig strand E 7310..7314 CDD:409353 1/3 (33%)
Ig strand F 7324..7329 CDD:409353 3/4 (75%)
Ig strand G 7337..7340 CDD:409353 1/2 (50%)
Ig 7361..7438 CDD:472250 15/86 (17%)
Ig strand B 7365..7369 CDD:409353 0/3 (0%)
Ig strand C 7378..7382 CDD:409353 1/3 (33%)
Ig strand E 7406..7410 CDD:409353 0/3 (0%)
Ig strand F 7420..7425 CDD:409353 1/10 (10%)
FN3 <7421..7762 CDD:442628 47/369 (13%)
Ig strand G 7433..7436 CDD:409353 0/2 (0%)
I-set 7648..7737 CDD:400151 10/95 (11%)
Ig strand B 7665..7669 CDD:409353 0/3 (0%)
Ig strand C 7678..7682 CDD:409353 0/3 (0%)
Ig strand E 7703..7707 CDD:409353 1/10 (10%)
Ig strand F 7717..7722 CDD:409353 0/4 (0%)
Ig strand G 7730..7733 CDD:409353 1/2 (50%)
Ig 7758..7833 CDD:472250 10/74 (14%)
Ig strand B 7761..7765 CDD:409353 0/3 (0%)
Ig strand C 7774..7778 CDD:409353 0/3 (0%)
Ig strand E 7799..7803 CDD:409353 0/3 (0%)
Ig strand F 7813..7818 CDD:409353 0/4 (0%)
Ig strand G 7826..7829 CDD:409353 0/2 (0%)
FN3 7837..7927 CDD:238020 18/89 (20%)
STKc_Twitchin_like 7986..8244 CDD:271016
Ig 8313..8401 CDD:472250
Ig strand B 8329..8333 CDD:409541
Ig strand C 8342..8346 CDD:409541
Ig strand E 8367..8371 CDD:409541
Ig strand F 8381..8386 CDD:409541
Ig strand G 8394..8397 CDD:409541
I-set 8437..8525 CDD:400151
Ig strand B 8454..8458 CDD:409353
Ig strand C 8467..8471 CDD:409353
Ig strand E 8491..8495 CDD:409353
Ig strand F 8505..8510 CDD:409353
Ig strand G 8518..8521 CDD:409353
I-set 8632..8721 CDD:400151
Ig strand B 8649..8653 CDD:409570
Ig strand C 8662..8666 CDD:409570
Ig strand E 8687..8691 CDD:409570
Ig strand F 8701..8706 CDD:409570
Ig strand G 8714..8717 CDD:409570
I-set 8740..8831 CDD:400151
Ig strand B 8757..8761 CDD:409353
Ig strand C 8770..8774 CDD:409353
Ig strand E 8795..8799 CDD:409353
Ig strand F 8809..8814 CDD:409353
Ig strand G 8822..8825 CDD:409353
Ig 8839..8922 CDD:472250
Ig strand B 8856..8860 CDD:409353
Ig strand C 8868..8872 CDD:409353
Ig strand E 8894..8898 CDD:409353
nrg2bXP_005157176.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.