DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and HESX1

DIOPT Version :10

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_003856.1 Gene:HESX1 / 8820 HGNCID:4877 Length:185 Species:Homo sapiens


Alignment Length:138 Identity:46/138 - (33%)
Similarity:61/138 - (44%) Gaps:35/138 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   399 HSLSPPNDIESLASIGHQRNCPVATEDIHLKKELDGHQSDETGSGEGENSNGGASNIGNTEDDQA 463
            |..:||:.|...:.:.|    |:..|                          .||...|......
Human    61 HVPNPPSGISFPSVVDH----PMPEE--------------------------RASKYENYFSASE 95

  Fly   464 RLILKRKL-----QRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRR 523
            ||.|||:|     :|.||:||.:||:.||..|....||.:..||.||.|:.|.|.|||:||.|||
Human    96 RLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRR 160

  Fly   524 AKWRREEK 531
            ||.:|..:
Human   161 AKLKRSHR 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeodomain 473..528 CDD:459649 29/54 (54%)
HESX1NP_003856.1 Homeodomain 109..165 CDD:459649 29/55 (53%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.