DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and YHP1

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_010739.3 Gene:YHP1 / 852062 SGDID:S000002859 Length:353 Species:Saccharomyces cerevisiae


Alignment Length:322 Identity:57/322 - (17%)
Similarity:111/322 - (34%) Gaps:86/322 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 TSLSEIPISSAPNIASVTAYASGPSLAHSLSPPNDIESLASIGHQRNCPVATEDIHLKKELDGHQ 436
            ||::  |:|....::|.:.:.....:.....||..:.|.             :.:::...|...:
Yeast    86 TSMT--PLSKPKKLSSHSPFTPTVRVCSKEQPPQSMHSY-------------KKVNILTPLSAAK 135

  Fly   437 SDETGSGEGENSNGGASNIGNTED--------DQARLILKRKLQRNRTSFTNDQIDSLEKEFERT 493
            :..|.:...|.....|....:.|.        |.||| .:||  |.|||  :.::..|:..|:..
Yeast   136 AVLTPTTRKEKKRSFAFITHSQETFPKKEPKIDNARL-ARRK--RRRTS--SYELGILQTAFDEC 195

  Fly   494 HYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRRTPNSTGASATSSSTSATASLT 558
            ..|:...|..|:.:..:.|..:|:||.|:|      :..:..:.:.|::.....|:.:.:..|.:
Yeast   196 PTPNKAKRIELSEQCNMSEKSVQIWFQNKR------QAAKKHKNSGNTSHCKVHSNDSMSMISYS 254

  Fly   559 DSPNSLSACSSLLSGSAGGPSVSTINGLSSPSTLSTNVNAPTLGAGIDSSESPTPIPHIRPSCTS 623
            |:...::                     |:|::....:.|..|.....::.|.....||.|    
Yeast   255 DAALEIT---------------------STPTSTKEAITAELLKTSPANTSSIFEDHHITP---- 294

  Fly   624 DNDNGRQSEDCRRVCSPCPLGVGGHQNTHH--------IQSNGHAQGHALVPAISPRLNFNS 677
                          |.|     ||....|.        :.:.||::..........||.||:
Yeast   295 --------------CKP-----GGQLKFHRKSVLVKRTLSNTGHSEIIKSPKGKENRLKFNA 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 14/51 (27%)
YHP1NP_010739.3 COG5576 123..278 CDD:227863 34/186 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.