DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and NKX6-2

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_796374.2 Gene:NKX6-2 / 84504 HGNCID:19321 Length:277 Species:Homo sapiens


Alignment Length:249 Identity:60/249 - (24%)
Similarity:95/249 - (38%) Gaps:72/249 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   375 SEIPISSAPNIASVTAY---ASGPSLAHSLSPPNDIESLASI----------GHQRNCPVATEDI 426
            :::|:.:...|:.:...   |:|..|...|...|.:.|.|.:          |:.:  |:|    
Human    50 AQLPLGTPHGISDILGRPVGAAGGGLLGGLPRLNGLASSAGVYFGPAAAVARGYPK--PLA---- 108

  Fly   427 HLKKELDGH-----QSDETGSGEGENSNGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSL 486
                ||.|.     .....|:...:....|.:..|...|...      |.:.:|.:|:..||.:|
Human   109 ----ELPGRPPIFWPGVVQGAPWRDPRLAGPAPAGGVLDKDG------KKKHSRPTFSGQQIFAL 163

  Fly   487 EKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRRE----------------EKLR-- 533
            ||.||:|.|.....|.|||..:|:.|::::|||.|||.|||:.                |||:  
Human   164 EKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAVEMASAKKKQDSDAEKLKVG 228

  Fly   534 ----------NQRRTPNSTGASATSSSTSATASLTDSPNSLSACSSLLSGSAGG 577
                      |:...|||.....|.....      ..|::|    :|:|...||
Human   229 GSDAEDDDEYNRPLDPNSDDEKITRLLKK------HKPSNL----ALVSPCGGG 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 24/51 (47%)
NKX6-2NP_796374.2 Repressor domain. /evidence=ECO:0000250|UniProtKB:D3Z4R4 89..142 10/62 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 132..155 5/28 (18%)
Homeobox 151..204 CDD:306543 24/52 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..250 7/39 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.