DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and HDG7

DIOPT Version :10

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_001332093.1 Gene:HDG7 / 835293 AraportID:AT5G52170 Length:687 Species:Arabidopsis thaliana


Alignment Length:235 Identity:46/235 - (19%)
Similarity:77/235 - (32%) Gaps:51/235 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   459 EDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRR 523
            ||.|.:...|:|.:......|:.||..||..|:...:|:...|..|..|:.|...:|:.||.|||
plant    45 EDKQEQRPKKKKRKTKYHRHTSYQIQELESFFKECPHPNEKQRLELGKKLTLESKQIKFWFQNRR 109

  Fly   524 AKWRRE-EKLRNQRRTPNSTGASATSSSTSATASLTDSPNSLSACSSLLSGSAGGPSVSTINGLS 587
            .:.:.: |:..|                    ..|......|...:|.|..|..|.......|..
plant   110 TQMKTQLERHEN--------------------VILKQENEKLRLENSFLKESMRGSLCIDCGGAV 154

  Fly   588 SPSTLSTNVNAPTLGAGIDSSESPTPIPHIRPSCTSDNDNGRQSEDCRRVCSPCPLGVGGHQNTH 652
            .|..:|...:...:                        :|.:..|:..|:|:.....:||..:..
plant   155 IPGEVSFEQHQLRI------------------------ENAKLKEELDRICALANRFIGGSISLE 195

  Fly   653 HIQSNGHAQGHALVPAISPRLNFNSGSFGAMYSNMHHTAL 692
            ...:.|....|.      |..:..||....|:.::...|:
plant   196 QPSNGGIGSQHL------PIGHCVSGGTSLMFMDLAMEAM 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeodomain 473..528 CDD:459649 17/54 (31%)
HDG7NP_001332093.1 Homeodomain 61..113 CDD:459649 17/51 (33%)
START_ArGLABRA2_like 220..425 CDD:176884 2/10 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.