DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and HAT2

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_199548.1 Gene:HAT2 / 834784 AraportID:AT5G47370 Length:283 Species:Arabidopsis thaliana


Alignment Length:274 Identity:62/274 - (22%)
Similarity:107/274 - (39%) Gaps:58/274 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 VGQSPNHLGTRSSHPQLVHGNHQALQQHQQQSWPPRHYSGSWYPTS-LSEIPISSAPNIASVTAY 391
            :|.|.||      :|..::.|..:...:..|..|   ::.::.||| |.:|.::|.|:..:....
plant    14 LGFSQNH------NPLQMNLNPNSSLSNNLQRLP---WNQTFDPTSDLRKIDVNSFPSTVNCEED 69

  Fly   392 ASGPSLAHSLSPPNDIESLASIGHQRNCPVATEDIHLKKELDGHQSDETGSGEGEN----SNGGA 452
            .       .:|.||...| ::|..:|:            |.:|......|||:..:    ..|.:
plant    70 T-------GVSSPNSTIS-STISGKRS------------EREGISGTGVGSGDDHDEITPDRGYS 114

  Fly   453 SNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQV 517
            ....:.|:|..      :..|.:...:.||...||:.|:..:..:...:..||.|:.|...:::|
plant   115 RGTSDEEEDGG------ETSRKKLRLSKDQSAFLEETFKEHNTLNPKQKLALAKKLNLTARQVEV 173

  Fly   518 WFSNRRAKWRRE-------------EKL--RNQRRTPNSTGASATSSSTSATASLTDSPNSLSAC 567
            ||.||||:.:.:             |||  .|:|....:........|......:| .|.:|..|
plant   174 WFQNRRARTKLKQTEVDCEYLKRCVEKLTEENRRLQKEAMELRTLKLSPQFYGQMT-PPTTLIMC 237

  Fly   568 SSLLSGSAGGPSVS 581
            .|  ....||||.|
plant   238 PS--CERVGGPSSS 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 16/51 (31%)
HAT2NP_199548.1 HD-ZIP_N 8..91 CDD:398351 22/105 (21%)
HOX 129..183 CDD:197696 17/53 (32%)
HALZ 185..228 CDD:128634 6/42 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.