DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and HDG4

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_193506.2 Gene:HDG4 / 827492 AraportID:AT4G17710 Length:709 Species:Arabidopsis thaliana


Alignment Length:256 Identity:61/256 - (23%)
Similarity:96/256 - (37%) Gaps:60/256 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 ISSAPNIASVTAYASGPSLAHSLSPPNDIESLASIGHQRNCPVATEDIHLKKELDGHQSDETGSG 443
            :||:|     |.....|:...|...|             |.|.    |..|:|.:.....|:|||
plant    23 VSSSP-----TTTIQNPNYFTSFENP-------------NFPY----IFPKEEYEVMSKIESGSG 65

  Fly   444 EGENSNGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKI 508
            :...|  |...:.||..:|.....|:|.....|:   .||..:|..|:...:||...|.||:.|:
plant    66 KSTGS--GHDPVENTAIEQEPPAAKKKRYHRHTA---SQIQQMEALFKENAHPDTKTRLRLSKKL 125

  Fly   509 GLPEARIQVWFSNRRAKWRREEKLRNQRRTPNSTGASATSSSTSATASLTDSPNSLSACSSLLSG 573
            ||...:::.||.|:|.:.:.:     |.|:.|     |...:.:.|.. |:|.|..|....|...
plant   126 GLSPIQVKFWFQNKRTQIKAQ-----QSRSDN-----AKLKAENETLK-TESQNIQSNFQCLFCS 179

  Fly   574 SAGGPSVSTINGLSSPSTLSTNVNAPTLGAGID------SSESPTPIPHIRPSCT-SDNDN 627
            :.|.               :..:....|...:|      |..:|:|...|.|... ::|||
plant   180 TCGH---------------NLRLENARLRQELDRLRSIVSMRNPSPSQEITPETNKNNNDN 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 17/51 (33%)
HDG4NP_193506.2 MRP-L20 24..147 CDD:289585 40/154 (26%)
Homeobox 91..144 CDD:278475 17/55 (31%)
MreC 105..>197 CDD:302802 25/117 (21%)
START_ArGLABRA2_like 233..462 CDD:176884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.