DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and HAT3

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_191598.1 Gene:HAT3 / 825210 AraportID:AT3G60390 Length:315 Species:Arabidopsis thaliana


Alignment Length:304 Identity:60/304 - (19%)
Similarity:103/304 - (33%) Gaps:116/304 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 SSHPQLVHGNHQALQQHQQQS--WPPRHYSGSW---YPTS---------LSEIPISSAPNIASVT 389
            |||           .||.|||  ..|:....:|   :.:|         |..|.::.||:...|.
plant    38 SSH-----------MQHMQQSNYNHPQKIQNTWINMFQSSERNSDMRSFLRGIDVNRAPSTVVVD 91

  Fly   390 AYASGPSLAHSLSPPNDIESLAS--------------IGHQRNCPVATEDIHLKK---ELDGHQS 437
            ....|..::   ||.:.:.|:.|              :|..|     .||..:::   .|.|...
plant    92 VEDEGAGVS---SPNSTVSSVMSGKKSERELMAAAGAVGGGR-----VEDNEIERASCSLGGGSD 148

  Fly   438 DETGSGEGENSNGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARE 502
            ||.|||.|::|:                       |.:...:.:|...||:.|:.....:...:.
plant   149 DEDGSGNGDDSS-----------------------RKKLRLSKEQALVLEETFKEHSTLNPKQKM 190

  Fly   503 RLAGKIGLPEARIQVWFSNRRAKWRRE-------------EKLRNQRR----------------- 537
            .||.::.|...:::|||.||||:.:.:             |.|.::.|                 
plant   191 ALAKQLNLRTRQVEVWFQNRRARTKLKQTEVDCEYLKRCCENLTDENRRLQKEVSELRALKLSPH 255

  Fly   538 -------------TPNSTGASATSSSTSATASLTDSPNSLSACS 568
                         .|:....:.||||:|....:.:|.:.:...|
plant   256 LYMHMKPPTTLTMCPSCERVAVTSSSSSVAPPVMNSSSPMGPMS 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 14/51 (27%)
HAT3NP_191598.1 HD-ZIP_N 19..118 CDD:398351 21/93 (23%)
Homeobox 165..215 CDD:395001 14/49 (29%)
HALZ 217..260 CDD:128634 3/42 (7%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.