DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and HB17

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_178252.2 Gene:HB17 / 814671 AraportID:AT2G01430 Length:275 Species:Arabidopsis thaliana


Alignment Length:234 Identity:49/234 - (20%)
Similarity:75/234 - (32%) Gaps:87/234 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   402 SPPNDIESLASIGHQRNCPVATEDIHLKKELDGHQSDETGSGEGENSNGGASNIGNTEDDQARLI 466
            :|.|.:..:.:|     .|..:.::.|...:.|..|.....   |.|.||.        ||.||.
plant    65 NPNNSLIKIMAI-----LPENSSNLDLTISVPGFSSSPLSD---EGSGGGR--------DQLRLD 113

  Fly   467 LKR------------------KLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEA 513
            :.|                  ...|.:...|.:|...||..|.:.|..:...:|.||..:.|...
plant   114 MNRLPSSEDGDDEEFSHDDGSAPPRKKLRLTREQSRLLEDSFRQNHTLNPKQKEVLAKHLMLRPR 178

  Fly   514 RIQVWFSNRRA---------------KW------------RREEKLRNQRRTPNSTGASATSSST 551
            :|:|||.||||               :|            |..|:||..:..|.:          
plant   179 QIEVWFQNRRARSKLKQTEMECEYLKRWFGSLTEENHRLHREVEELRAMKVGPTT---------- 233

  Fly   552 SATASLTDSPNSLSACSSLLSGSAGGPSVSTINGLSSPS 590
                  .:|.:||:.|          |....:...:|||
plant   234 ------VNSASSLTMC----------PRCERVTPAASPS 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 19/78 (24%)
HB17NP_178252.2 HOX 136..192 CDD:197696 19/55 (35%)
HALZ 194..237 CDD:128634 6/58 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.