DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and lhx2a

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:XP_017208320.1 Gene:lhx2a / 795283 ZFINID:ZDB-GENE-091118-109 Length:328 Species:Danio rerio


Alignment Length:200 Identity:56/200 - (28%)
Similarity:83/200 - (41%) Gaps:40/200 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   427 HLKKE--LDGHQSD----ETGSG---------------EGENSNGGASNIGNTED------DQAR 464
            |:::|  .|.:.||    ||.|.               ....:|..|.:|..:.|      |.:.
Zfish   129 HIQRECHADLYYSDMSSRETNSESHTYDEESPVHRARVRRRKNNSTADHIAYSSDVSDLGVDLSE 193

  Fly   465 LILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRRE 529
            .:..:|.:|.||||.:.|:.|::..|...|.||....:.||.|.||.:..:||||.|.|||:||.
Zfish   194 RVSCQKSKRMRTSFKHHQLRSMQSFFTHNHNPDAKDLKELAQKTGLTKRVLQVWFQNARAKFRRN 258

  Fly   530 EKLRNQRRTPNSTGASATSSSTSATASLTDSPNSLSACSSLLSGSAGGPSVSTINGLSSPSTLST 594
            ...:      .|.|....|.:::.|:....||.......|..|.|...||..|      ||. :.
Zfish   259 CLYQ------ESIGVDNVSDNSTLTSPSVPSPELCHGSMSPSSPSGTSPSQHT------PSA-AR 310

  Fly   595 NVNAP 599
            |.::|
Zfish   311 NTHSP 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 23/51 (45%)
lhx2aXP_017208320.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.