Sequence 1: | NP_001014693.1 | Gene: | ey / 43812 | FlyBaseID: | FBgn0005558 | Length: | 898 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001035436.3 | Gene: | pitx1 / 678598 | ZFINID: | ZDB-GENE-060421-3623 | Length: | 285 | Species: | Danio rerio |
Alignment Length: | 235 | Identity: | 70/235 - (29%) |
---|---|---|---|
Similarity: | 104/235 - (44%) | Gaps: | 58/235 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 436 QSDETGSGEGENSNGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFA 500
Fly 501 RERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQR----------------------------- 536
Fly 537 ------------RTPNSTGASATSSSTSATASLTDSPNSLSACSSLLS-GSAGGPSVSTINGLSS 588
Fly 589 PSTLSTNVNAPTLGAGIDSSESP-----TPIPHIRPSCTS 623 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ey | NP_001014693.1 | PAX | 98..221 | CDD:128645 | |
Homeobox | 475..527 | CDD:278475 | 27/51 (53%) | ||
pitx1 | NP_001035436.3 | COG5576 | 8..>126 | CDD:227863 | 45/104 (43%) |
Homeobox | 62..114 | CDD:278475 | 27/51 (53%) | ||
OAR | 247..263 | CDD:281777 | 2/5 (40%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R6207 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |