DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and pitx1

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_001035436.3 Gene:pitx1 / 678598 ZFINID:ZDB-GENE-060421-3623 Length:285 Species:Danio rerio


Alignment Length:235 Identity:70/235 - (29%)
Similarity:104/235 - (44%) Gaps:58/235 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   436 QSDETGSGEGENSNGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFA 500
            :|.:|.:.|.|.|....|:.||.:|.:     |:|.:|.||.||:.|:..||..|:|..|||:..
Zfish    28 ESSDTEAAEKERSVEQRSDDGNADDPK-----KKKQRRQRTHFTSQQLQELEATFQRNRYPDMST 87

  Fly   501 RERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQR----------------------------- 536
            ||.:|....|.|||::|||.|||||||:.|  |||:                             
Zfish    88 REEIAVWTNLTEARVRVWFKNRRAKWRKRE--RNQQMDLCKNSYLPQFSGLMQPYDDVYPTYTYN 150

  Fly   537 ------------RTPNSTGASATSSSTSATASLTDSPNSLSACSSLLS-GSAGGPSVSTINGLSS 588
                        .|.|.|..::.|..||  .|:..:|:|:|:.|.... |.:..|.:.| .||::
Zfish   151 NWTNKGLTPAPLSTKNFTFFNSMSPLTS--QSMFSAPSSISSMSMASGMGHSAVPGMPT-TGLNN 212

  Fly   589 PSTLSTNVNAPTLGAGIDSSESP-----TPIPHIRPSCTS 623
            ...|: .:...|:...:.||..|     :|....|.:|.|
Zfish   213 IGNLN-GIGGSTINPAMSSSTCPYGPPVSPYSVYRDTCNS 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 27/51 (53%)
pitx1NP_001035436.3 COG5576 8..>126 CDD:227863 45/104 (43%)
Homeobox 62..114 CDD:278475 27/51 (53%)
OAR 247..263 CDD:281777 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.