DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and SHOX2

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_003021.3 Gene:SHOX2 / 6474 HGNCID:10854 Length:355 Species:Homo sapiens


Alignment Length:440 Identity:93/440 - (21%)
Similarity:135/440 - (30%) Gaps:238/440 - (54%)


- Green bases have known domain annotations that are detailed below.


  Fly   441 GSGEGENSNGGAS-----NIGNTE--------------------DDQARLIL------------- 467
            |.|.|..:.||.|     ::|..|                    :.||.|:|             
Human    80 GGGAGGGAGGGRSPVRELDMGAAERSREPGSPRLTEGRRKPTKAEVQATLLLPGEAFRFLVSPEL 144

  Fly   468 ----------------KRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQ 516
                            |.|.:|:||:||.:|::.||:.|:.|||||.|.||.|:.::||.|||:|
Human   145 KDRKEDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQ 209

  Fly   517 VWFSNRRAKWRREEKLRNQRRTPNSTGASATSSSTSATASLTDSPNSLSACSSLLSGSAGGPSVS 581
            |||.|||||.|::|                               |.|.  ..:|.|:|.     
Human   210 VWFQNRRAKCRKQE-------------------------------NQLH--KGVLIGAAS----- 236

  Fly   582 TINGLSSPSTLSTNVNAPTLGAGIDSSESPTPIPHIRPSCTSDNDNGRQSEDCRRVCSPCPLGVG 646
                                                            |.|.||           
Human   237 ------------------------------------------------QFEACR----------- 242

  Fly   647 GHQNTHHIQSNGHAQGHALVPAISPRLNFNSGSFGAMYSNMHHTALSM---SDSYGAVTPIPSFN 708
                                  ::|.:|..              ||.|   .||:..|||: ||.
Human   243 ----------------------VAPYVNVG--------------ALRMPFQQDSHCNVTPL-SFQ 270

  Fly   709 HSAVGPLAPPSPIPQQGDLTPSSLYPCHMTLRPPPMAPAHHHIVPGDGGRPAGVGLGSGQSANLG 773
                          .|..|...|           .:|.||||:.|                 :|.
Human   271 --------------VQAQLQLDS-----------AVAHAHHHLHP-----------------HLA 293

  Fly   774 ASCSGSGYEVLSA--YALPPPPMASSSAADSSFSAASSASANVTPHHTIA 821
            |.   :.|.:..|  :.||...:|:.||:.:|..||::|:...:.:.:||
Human   294 AH---APYMMFPAPPFGLPLATLAADSASAASVVAAAAAAKTTSKNSSIA 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 31/51 (61%)
SHOX2NP_003021.3 Homeobox 167..220 CDD:306543 31/52 (60%)
OAR 335..351 CDD:309087 2/6 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.