DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and SHOX

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_000442.1 Gene:SHOX / 6473 HGNCID:10853 Length:292 Species:Homo sapiens


Alignment Length:163 Identity:56/163 - (34%)
Similarity:78/163 - (47%) Gaps:45/163 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   405 NDIESLASIGHQRNCPVATEDIHLKKELDGHQSDETGSGEGENSNGGASNIGNTEDDQARLILKR 469
            ||.|.|...|..|   ||......|::.:..:|::                   ||.|.:|    
Human    77 NDKEKLKEFGTAR---VAEGIYECKEKREDVKSED-------------------EDGQTKL---- 115

  Fly   470 KLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRN 534
            |.:|:||:||.:|::.||:.|:.|||||.|.||.|:.::||.|||:||||.|||||.|::|   |
Human   116 KQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQE---N 177

  Fly   535 QRRTPNSTGASATSSSTSATASLTDSPNSLSAC 567
            |.......|.:                |.|.||
Human   178 QMHKGVILGTA----------------NHLDAC 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 31/51 (61%)
SHOXNP_000442.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..119 6/41 (15%)
Homeobox 120..174 CDD:395001 31/53 (58%)
SH3-binding. /evidence=ECO:0000255 242..249
OAR 272..288 CDD:397759
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 274..287
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.