DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ey and Rhox4f

DIOPT Version :9

Sequence 1:	NP_001014693.1	Gene:	ey / 43812	FlyBaseID:	FBgn0005558	Length:	898	Species:	Drosophila melanogaster
Sequence 2:	NP_001034785.1	Gene:	Rhox4f / 636177	MGIID:	3613392	Length:	205	Species:	Mus musculus

Alignment Length:	138	Identity:	35/138 - (25%)
Similarity:	55/138 - (39%)	Gaps:	45/138 - (32%)

- Green bases have known domain annotations that are detailed below.

  Fly   432 LDGHQSDETGSGEG----------ENSNGGASNIGNTEDDQARL----ILK-------------- 468
            ::|.:::|. ||||          :|||....:...:..::.:|    :||
Mouse    52 VEGDKAEEL-SGEGGPAAGDADLMDNSNQEDQDTSGSAQEEEKLPEEPVLKDAVVIDKVQPIPVL 115

  Fly   469 -------------RKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFS 520
                         |.|..|   |...|:..||:.|::.|:.....|..||..||:.|||:..||.
Mouse   116 VSGVRPKSVWVQQRSLHYN---FQWWQLQELERIFQQNHFIRAEERRHLARWIGVSEARVMTWFK 177

  Fly   521 NRRAKWRR 528
            .||..:||
Mouse   178 KRREHFRR 185

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ey	NP_001014693.1	PAX	98..221	CDD:128645
ey	NP_001014693.1	Homeobox	475..527	CDD:278475	18/51 (35%)
Rhox4f	NP_001034785.1	P-loop_NTPase	44..>126	CDD:304359	12/74 (16%)
Rhox4f	NP_001034785.1	homeodomain	129..187	CDD:238039	23/60 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910