DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and Rhox4f

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_001034785.1 Gene:Rhox4f / 636177 MGIID:3613392 Length:205 Species:Mus musculus


Alignment Length:138 Identity:35/138 - (25%)
Similarity:55/138 - (39%) Gaps:45/138 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   432 LDGHQSDETGSGEG----------ENSNGGASNIGNTEDDQARL----ILK-------------- 468
            ::|.:::|. ||||          :|||....:...:..::.:|    :||              
Mouse    52 VEGDKAEEL-SGEGGPAAGDADLMDNSNQEDQDTSGSAQEEEKLPEEPVLKDAVVIDKVQPIPVL 115

  Fly   469 -------------RKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFS 520
                         |.|..|   |...|:..||:.|::.|:.....|..||..||:.|||:..||.
Mouse   116 VSGVRPKSVWVQQRSLHYN---FQWWQLQELERIFQQNHFIRAEERRHLARWIGVSEARVMTWFK 177

  Fly   521 NRRAKWRR 528
            .||..:||
Mouse   178 KRREHFRR 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 18/51 (35%)
Rhox4fNP_001034785.1 P-loop_NTPase 44..>126 CDD:304359 12/74 (16%)
homeodomain 129..187 CDD:238039 23/60 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.