DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and hoxa5a

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_571615.1 Gene:hoxa5a / 58055 ZFINID:ZDB-GENE-000823-9 Length:227 Species:Danio rerio


Alignment Length:219 Identity:63/219 - (28%)
Similarity:87/219 - (39%) Gaps:53/219 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 PRHYSGSW-----YPTSLSEIPIS-SAPNIASVTAYASGPSLAHSLSPPNDIESLASIGHQRNCP 420
            |.|:..|.     |..|.:..|:. :.|    |||.::.||..|.     ...|||      |.|
Zfish    22 PGHFLSSGERTQSYKDSPTATPVRYNQP----VTASSAEPSSDHL-----PCSSLA------NSP 71

  Fly   421 VATEDIH--LKKELD---GHQSDETG---SGEG---------ENSNGGASNIGNTEDDQARLIL- 467
            | :|..|  ||..|.   |..|...|   |.||         |....|:....:....:|..|. 
Zfish    72 V-SEQSHRALKISLSSTAGSASKSFGTVLSREGVSKVSSSMEEEKPPGSGQTASQNVSEAPQIYP 135

  Fly   468 -KRKL------------QRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWF 519
             .|||            :|.||::|..|...|||||....|.....|..:|..:.|.|.:|::||
Zfish   136 WMRKLHISHDNLAGPEGKRPRTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWF 200

  Fly   520 SNRRAKWRREEKLRNQRRTPNSTG 543
            .|||.||:::.||::.......:|
Zfish   201 QNRRMKWKKDNKLKSMNMAAAGSG 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 21/51 (41%)
hoxa5aNP_571615.1 Homeobox 155..208 CDD:278475 21/52 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.