DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and hoxa9b

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_571608.1 Gene:hoxa9b / 58048 ZFINID:ZDB-GENE-000823-2 Length:258 Species:Danio rerio


Alignment Length:263 Identity:54/263 - (20%)
Similarity:88/263 - (33%) Gaps:85/263 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 QSPNHLGTR-SSHPQLVHGNHQ--ALQQHQQQSW----PPRHYSGSWYPTSLSEIPISSAPNI-- 385
            ::.:||..| ||.|.:...:.:  .|:..:|:.:    ....:..||.|...:...|:..|.|  
Zfish    18 ENDDHLAPRFSSGPVVQQQSRELTLLEYSEQEPYTFQAKSSIFGASWSPVQPTGASIAYHPYIHH 82

  Fly   386 ---------ASVTAYA---------------------------SGPSLAHSL------------- 401
                     |||..:|                           ||....|:|             
Zfish    83 PCSTGDSDGASVRPWALEPLPALPFTGLSTDTHQDIKLEPLVGSGECTTHTLLVAETDNNTTQTE 147

  Fly   402 -SPPNDIESLASIGHQRNCPVATEDIHLKKELDGHQSDETGSGEGENSNGGASNIGNTEDDQARL 465
             ..|:|..|..|  |....|..|     |.:||..:.                   |.::..:..
Zfish   148 RKVPDDAVSNGS--HDEKIPAET-----KLDLDPSKC-------------------NQDNPLSNW 186

  Fly   466 ILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREE 530
            :..:..::.|..:|..|...|||||....|.....|..:|..:.|.|.::::||.|||.|.::..
Zfish   187 LHAKSTRKKRCPYTKHQTLELEKEFLFNMYLSRDRRYEVARLLNLTERQVKIWFQNRRMKMKKCN 251

  Fly   531 KLR 533
            |.|
Zfish   252 KDR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 19/51 (37%)
hoxa9bNP_571608.1 Hox9_act 1..174 CDD:282473 31/162 (19%)
Homeobox 195..248 CDD:278475 19/52 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.