DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and pax1b

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:XP_700877.6 Gene:pax1b / 572108 ZFINID:ZDB-GENE-060503-372 Length:340 Species:Danio rerio


Alignment Length:385 Identity:131/385 - (34%)
Similarity:173/385 - (44%) Gaps:86/385 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 DECHSGVNQLGGVFVGGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSI 159
            |:.:..|||||||||.|||||::.|.:|||||..|.|||||||.|:||:|||||||.||.|||||
Zfish     4 DQTYGEVNQLGGVFVNGRPLPNAIRIRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSI 68

  Fly   160 RPRAIGGSKPRVATAEVVSKISQYKRECPSIFAWEIRDRLLQENVCTNDNIPSVSSINRVLRNLA 224
            .|.|||||||||.|..||..|..||:..|.|||||||||||.:.||...|:||||||:|:|||..
Zfish    69 LPGAIGGSKPRVTTPNVVKSIRDYKQGDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRILRNKI 133

  Fly   225 AQKEQQSTGSGSSS------------------TSAGNSISAKVSVSIG--------GNVSNVASG 263
            ....|.|.....:|                  :..|:.:.:..:||:.        ..|||:. |
Zfish   134 GNLSQPSQYDSKTSPPQISYNPVYPYSYPNTMSPTGSKLGSPPAVSVSLSRAWPSVHTVSNIL-G 197

  Fly   264 SRGTL--------SSSTDLMQTATPLNSSESGGASNSGEGSEQEAIYEKLRLLNTQHAAGPGPLE 320
            .|..:        .|....|:..|.:| ..|..:.:...|.::..:...::.  ||.::......
Zfish   198 IRAFMDPAAIAGSESYQPKMEDWTGVN-RPSFPSVHGVNGIDKPPLESDIKY--TQASSNLSGYV 259

  Fly   321 PARAAPLVGQSPNHLGTRSSHPQLVHGNHQALQQHQQQSWPPRHYSGSWYPTSLSEIPISSAPNI 385
            ||.|.....|...:.|         |||:                 |.|...|..    .|.||.
Zfish   260 PACAYSATNQYGVYGG---------HGNY-----------------GHWQSQSAG----LSHPNT 294

  Fly   386 ASVTAYASGPSLAHSLSPPNDIESLASIGHQRNCPVATEDIHLKKELDGHQSDETGSGEG 445
            .::   ...|:|..:||..|               .:.|.:..|..|..||.:...:..|
Zfish   295 GTM---IQSPNLHSALSFKN---------------TSREAVERKSPLSKHQHEGLSAVHG 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645 83/122 (68%)
Homeobox 475..527 CDD:278475
pax1bXP_700877.6 PAX 6..133 CDD:238076 86/126 (68%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.