DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and AgaP_AGAP001493

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:XP_001689344.2 Gene:AgaP_AGAP001493 / 5667704 VectorBaseID:AGAP001493 Length:387 Species:Anopheles gambiae


Alignment Length:377 Identity:132/377 - (35%)
Similarity:165/377 - (43%) Gaps:131/377 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 VNQLGGVFVGGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIG 165
            |||||||||.|||||:|||.:|||||..|.|||||||.|:||:|||||||.||:|||||.|.|||
Mosquito    42 VNQLGGVFVNGRPLPNSTRMRIVELARLGIRPCDISRQLRVSHGCVSKILARYHETGSILPGAIG 106

  Fly   166 GSKPRVATAEVVSKISQYKRECPSIFAWEIRDRLLQENVCTNDNIPSVSSINRVLR----NLA-- 224
            ||||||.|.:||:.|.:.|::.|.|||||||||||.:.||..:|:||||||:|:||    |||  
Mosquito   107 GSKPRVTTPKVVTYIRELKQKDPGIFAWEIRDRLLSDGVCDKNNVPSVSSISRILRNKLGNLAHH 171

  Fly   225 ------AQKEQQSTGSGSSSTSAG-----NSISAKVSVSIGGNVSNVASGSRGTLSSSTDLMQTA 278
                  .......||.|.:.|...     |||......:                         |
Mosquito   172 HHHPHHPHHPHAGTGGGGAHTPHAPAHLYNSIYPSYPYA-------------------------A 211

  Fly   279 TPLNSSESGGASNSGEGSEQEAIYEKLRLLNTQHAAGPGPLEPARAAPLVGQSPNHLGTRSSHPQ 343
            :.|.|..|.|.|                         |.|  |..|.|:  :||           
Mosquito   212 STLKSEMSCGGS-------------------------PSP--PTGATPI--RSP----------- 236

  Fly   344 LVHGNHQALQQHQQQSWPPRHYSGSWYPTSLSEIPISSAPNIASVTAYASG---PSLAHSLSPPN 405
                       |....||..|        |:::| :::..:.|:|.|..:|   .|..|:..||.
Mosquito   237 -----------HAHCPWPSSH--------SVTDI-LANVHHQATVAALRNGGTPTSQCHTTPPPT 281

  Fly   406 DIESLASIGHQRNCPVATEDIHLKKELDGHQSDETGSGEGENSNGGASNIGN 457
            .:                          |.|....|.|.|..:.||.:..||
Mosquito   282 SV--------------------------GGQLMSGGGGNGGGNGGGGAGNGN 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645 84/119 (71%)
Homeobox 475..527 CDD:278475
AgaP_AGAP001493XP_001689344.2 PAX 39..162 CDD:128645 84/119 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.