DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and AgaP_AGAP002372

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:XP_001688391.2 Gene:AgaP_AGAP002372 / 5667563 VectorBaseID:AGAP002372 Length:457 Species:Anopheles gambiae


Alignment Length:330 Identity:82/330 - (24%)
Similarity:116/330 - (35%) Gaps:98/330 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 SSTDLMQTATPLNSSESGGASNSG------EGSEQEAIYEKLRLLNTQHAAGPGPLEPARAAPLV 328
            :|:...|.:..:|||.|.|:..|.      |.|.|:|           ....|| |:|.      
Mosquito   107 NSSSNSQKSVSVNSSISSGSPRSSLAVDIEEDSSQDA-----------SIGSPG-LQPG------ 153

  Fly   329 GQSPNHLGTRSSHPQLVHGNHQALQQHQQQSWPP-RHY--SGSWYPTSLSEIPI-----SSAPNI 385
                     ...||:            |..::|| |||  :.|......||.|:     ......
Mosquito   154 ---------GGDHPR------------QPPAYPPLRHYGITSSSSTACASEYPVPTTIGGQCYGF 197

  Fly   386 ASVTAYASG-----PSLAHSLSPPNDIESLASIGHQRNCPVATEDIHLKKELDGHQSDETGSG-- 443
            .:||...|.     |..|..|:.|.|...:..:.|:..        |....:....|...|:|  
Mosquito   198 LAVTPQQSSSAGVLPVPAPHLTQPGDPALVGGLQHRPQ--------HGSMAVSTFFSSTGGAGGG 254

  Fly   444 ---------------EGENSNGGASNIGNTEDDQARLILKRKLQ----RNRTSFTNDQIDSLEKE 489
                           :|.....|.|         |.|..:||.:    |.||:|:::|...||.|
Mosquito   255 GYGPPSFRPFFGIAHDGPQLPAGLS---------AFLARRRKKEGRPRRQRTTFSSEQTLRLEVE 310

  Fly   490 FERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEK--LRNQRRTPNSTGASATSSSTS 552
            |.|..|.....|..||..:.|.|.:|::||.|||||.:|.||  :..|.||..:.....|..|..
Mosquito   311 FHRNEYISRGRRFELAEVLKLSETQIKIWFQNRRAKDKRIEKAQIDQQYRTFAAVNGLLTPFSPQ 375

  Fly   553 ATASL 557
            ..|:|
Mosquito   376 YPAAL 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 23/51 (45%)
AgaP_AGAP002372XP_001688391.2 Homeobox 296..348 CDD:278475 23/51 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.