DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and pax1a

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_001074061.1 Gene:pax1a / 564359 ZFINID:ZDB-GENE-070112-182 Length:359 Species:Danio rerio


Alignment Length:200 Identity:102/200 - (51%)
Similarity:125/200 - (62%) Gaps:26/200 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 DECHSGVNQLGGVFVGGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSI 159
            ::.:..|||||||||.|||||::.|.:|||||..|.|||||||.|:||:|||||||.||.|||||
Zfish     7 EQTYGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSI 71

  Fly   160 RPRAIGGSKPRVATAEVVSKISQYKRECPSIFAWEIRDRLLQENVCTNDNIPSVSSINRVLRNLA 224
            .|.|||||||||.|..||..|..||:..|.|||||||||||.:.||...|:||||||:|:|||..
Zfish    72 LPGAIGGSKPRVTTPNVVKNIRDYKQSDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRILRNKI 136

  Fly   225 AQKEQ------------QSTGS---------GSSSTSAGNSISAKVSVSI-GGNVSNVASGSRGT 267
            ....|            ||:.|         .::.:.:|..:|:...|.: ||:||.    |||.
Zfish   137 GNLSQPNPYENGKQAPPQSSLSYNHIYPYSYPNAMSPSGTKMSSPPGVPVTGGHVSI----SRGW 197

  Fly   268 LSSST 272
            .|:.|
Zfish   198 PSAHT 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645 83/122 (68%)
Homeobox 475..527 CDD:278475
pax1aNP_001074061.1 PAX 9..136 CDD:238076 86/126 (68%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.