DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and gsc

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_001016704.1 Gene:gsc / 549458 XenbaseID:XB-GENE-486771 Length:243 Species:Xenopus tropicalis


Alignment Length:115 Identity:42/115 - (36%)
Similarity:69/115 - (60%) Gaps:9/115 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   454 NIGNTEDDQARLILK---RKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARI 515
            |:|.....:.:|:.:   |:.:|:||.||::|:::||..|:.|.||||..||:||.::.|.|.::
 Frog   128 NVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARRVHLREEKV 192

  Fly   516 QVWFSNRRAKWRRE-----EKLRNQRRTPNSTGASATSSSTSATASLTDS 560
            :|||.||||||||:     |:..|.::. |.:..::|........|..||
 Frog   193 EVWFKNRRAKWRRQKRSSSEESENTQKW-NKSSKNSTEKGDEQVKSDLDS 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 27/51 (53%)
gscNP_001016704.1 Homeobox 151..204 CDD:278475 27/52 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.