DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and PRRX1

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_073207.1 Gene:PRRX1 / 5396 HGNCID:9142 Length:245 Species:Homo sapiens


Alignment Length:218 Identity:71/218 - (32%)
Similarity:104/218 - (47%) Gaps:45/218 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 PSLAHSLSPPNDIESLASIGHQRNCPVA-TEDIHLKKELDGHQSDETGSGEGEN---SNGGASNI 455
            |:|...|..|.::::|.:   ::|..|: ..|:....::...|:||.....|.:   |.|..|..
Human    13 PALGGRLDSPGNLDTLQA---KKNFSVSHLLDLEEAGDMVAAQADENVGEAGRSLLESPGLTSGS 74

  Fly   456 GNTEDDQARL----ILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQ 516
            ...:.|..:|    ..|||.:||||:|.:.|:.:||:.||||||||.|.||.||.::.|.|||:|
Human    75 DTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQ 139

  Fly   517 VWFSNRRAKWRREEK--LRNQ---------------------RRTPNST-----------GASAT 547
            |||.|||||:||.|:  |.|:                     |..|..|           .|.||
Human   140 VWFQNRRAKFRRNERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYSAMAT 204

  Fly   548 SSSTSATASLTDSPNSLSACSSL 570
            .|:|.|..|.....|..::.::|
Human   205 YSATCANNSPAQGINMANSIANL 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 32/51 (63%)
PRRX1NP_073207.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 3/8 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..103 13/39 (33%)
Homeobox 99..151 CDD:395001 31/51 (61%)
OAR 219..235 CDD:397759 2/9 (22%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 222..235 1/6 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.