Sequence 1: | NP_001014693.1 | Gene: | ey / 43812 | FlyBaseID: | FBgn0005558 | Length: | 898 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001091697.1 | Gene: | Sdcbp / 53378 | MGIID: | 1337026 | Length: | 299 | Species: | Mus musculus |
Alignment Length: | 198 | Identity: | 38/198 - (19%) |
---|---|---|---|
Similarity: | 64/198 - (32%) | Gaps: | 76/198 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 361 PPRHYSGSWYPTSLSE------IPISSAPNIASVTAYASGPSLAHSLSPPNDIESLASIGHQRNC 419
Fly 420 PVATED--------------IHLKKELDGH-----------------QSDETGS------GE--- 444
Fly 445 ---GENSNGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAG 506
Fly 507 KIG 509 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ey | NP_001014693.1 | PAX | 98..221 | CDD:128645 | |
Homeobox | 475..527 | CDD:278475 | 9/35 (26%) | ||
Sdcbp | NP_001091697.1 | Interaction with PDCD6IP. /evidence=ECO:0000269|PubMed:22660413 | 2..103 | 13/71 (18%) | |
LYPX(n)L motif 1. /evidence=ECO:0000305|PubMed:22660413 | 3..7 | ||||
LYPX(n)L motif 2. /evidence=ECO:0000305|PubMed:22660413 | 46..50 | 2/3 (67%) | |||
LYPX(n)L motif 3. /evidence=ECO:0000305|PubMed:22660413 | 50..54 | 0/3 (0%) | |||
PDZ_signaling | 113..192 | CDD:238492 | 17/85 (20%) | ||
PDZ_signaling | 197..270 | CDD:238492 | 6/19 (32%) | ||
phosphatidylinositol-4, 5-bisphosphate-binding. /evidence=ECO:0000250|UniProtKB:O00560 | 251..252 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0849 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |