DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and PRRX2

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_057391.1 Gene:PRRX2 / 51450 HGNCID:21338 Length:253 Species:Homo sapiens


Alignment Length:223 Identity:75/223 - (33%)
Similarity:104/223 - (46%) Gaps:37/223 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 ASGP----------SLAHSLSPPNDIESLASIGHQRNCPVATEDIH---LKKELDGHQSDETGSG 443
            |.||          |::|.|    |:|.:|:.|.....|.|..:..   .::...|....|....
Human    25 ALGPGDCAQARKNFSVSHLL----DLEEVAAAGRLAARPGARAEAREGAAREPSGGSSGSEAAPQ 85

  Fly   444 EGENSNGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKI 508
            :||..:.|..:....         |:|.:||||:|.:.|:.:||:.||||||||.|.||.||.::
Human    86 DGECPSPGRGSAAKR---------KKKQRRNRTTFNSSQLQALERVFERTHYPDAFVREELARRV 141

  Fly   509 GLPEARIQVWFSNRRAKWRREEKLRNQRRTPNSTGASATSS-STSATASLTDSPNSLSACSSLLS 572
            .|.|||:||||.|||||:|     ||:|....|..||...| |..|......:|...:.....||
Human   142 NLSEARVQVWFQNRRAKFR-----RNERAMLASRSASLLKSYSQEAAIEQPVAPRPTALSPDYLS 201

  Fly   573 GSAGGPSVSTI----NGLSSPSTLSTNV 596
            .:|..| .||:    .|.|.|:|...|:
Human   202 WTASSP-YSTVPPYSPGSSGPATPGVNM 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 32/51 (63%)
PRRX2NP_057391.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33 3/7 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..113 14/66 (21%)
Homeobox 109..161 CDD:395001 32/56 (57%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 230..243
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.