DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and Emx1

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:XP_575584.5 Gene:Emx1 / 500235 RGDID:1564002 Length:290 Species:Rattus norvegicus


Alignment Length:294 Identity:80/294 - (27%)
Similarity:113/294 - (38%) Gaps:103/294 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 SSSTDLMQTAT----PLNS--SESGGASNS----GEGSEQEAI---YEKLR--LLNTQHAAGPGP 318
            |::..:.|.||    .:.|  ::.||...|    |.||...|:   .|.||  .||..|   |..
  Rat    29 SAAATMFQPATKRGFTIESLVAKDGGTGGSPGSGGAGSHPLAVAASEEPLRPTALNYPH---PSA 90

  Fly   319 LEPA-----RAAPLVGQSPNHLGTRSSHPQLVHG---NHQALQQHQQQSWPPRHYSGSWYPTSLS 375
            .|.|     .||...|.|.:..|    .|:||..   ||.||..|      |.|..||       
  Rat    91 AETAFVSGFPAAAAAGASRSLYG----GPELVFPEAMNHPALTVH------PAHQLGS------- 138

  Fly   376 EIPISSAPNIASVTAYASGPSLAHSLSPPNDIESLASIGHQRNCPVATEDIH-----LKKELDGH 435
                                   .||.||:   |..|..|:       :.:|     |:....||
  Rat   139 -----------------------SSLQPPH---SFFSAQHR-------DPLHFYPWVLRNRFFGH 170

  Fly   436 QSDETGSGEGENSNGGASNIGNTEDDQARLIL----KRKLQRNRTSFTNDQIDSLEKEFERTHYP 496
            :...                  :|..|..|:|    .||.:|.||:|:..|:..||:.||:.||.
  Rat   171 RFQA------------------SEVPQDGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYV 217

  Fly   497 DVFARERLAGKIGLPEARIQVWFSNRRAKWRREE 530
            ....|::|||.:.|.|.:::|||.|||.|::|::
  Rat   218 VGAERKQLAGSLSLSETQVKVWFQNRRTKYKRQK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 23/51 (45%)
Emx1XP_575584.5 COG5576 141..>251 CDD:227863 41/137 (30%)
Homeobox 196..248 CDD:278475 23/51 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.