DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and dlx2

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_001008061.1 Gene:dlx2 / 493423 XenbaseID:XB-GENE-852891 Length:285 Species:Xenopus tropicalis


Alignment Length:299 Identity:66/299 - (22%)
Similarity:119/299 - (39%) Gaps:96/299 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 QSPNHLGTRSSHPQLVHGNHQ----ALQQHQQQSWPPRHYSGSWYPTSLSEIPISSAPNIASVTA 390
            |...|.|..|.:.||  |::|    ||             :|..|.|...::..|.  :.:|...
 Frog    49 QQQQHCGAGSPYGQL--GSYQFHGAAL-------------NGISYSTKSYDLTYSG--SYSSYGP 96

  Fly   391 YASGPSLAHSLSPPNDIESLASIGHQRNCPVATEDIHLKKELDGHQSDETGSGEGENSNGGASNI 455
            |.:.||     .|.||.|       :.:|                                    
 Frog    97 YGTSPS-----PPHNDPE-------KEDC------------------------------------ 113

  Fly   456 GNTEDDQARLI--LKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVW 518
                :.:.|::  ..:|:::.||.:::.|:.:|::.|::|.|..:..|..||..:||.:.::::|
 Frog   114 ----EPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIW 174

  Fly   519 FSNRRAK----WRREEKLRNQRRTPNSTGASATSSSTSATASLTDSPNSLSACSSLLSGSAGGPS 579
            |.|||:|    |:..|...:|  .|..:.:...:|..::||:....|:      ..|.|:|.|.:
 Frog   175 FQNRRSKFKKMWKSGEIPSDQ--LPVGSESPTCNSPPASTATWDFGPH------QRLQGAASGSA 231

  Fly   580 VSTINGLSSPSTLSTNVNAPTLGAGIDSSESPTPIPHIR 618
            :.:.|..||||        |.|| .....::..|.||::
 Frog   232 LQSSNSASSPS--------PFLG-NYSWYQTSNPAPHLQ 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 18/55 (33%)
dlx2NP_001008061.1 DLL_N 29..107 CDD:315147 19/79 (24%)
Homeobox 130..183 CDD:306543 18/52 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.