DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and AgaP_AGAP006537

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:XP_001237835.2 Gene:AgaP_AGAP006537 / 4576611 VectorBaseID:AGAP006537 Length:271 Species:Anopheles gambiae


Alignment Length:139 Identity:43/139 - (30%)
Similarity:58/139 - (41%) Gaps:37/139 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   433 DGHQSDETG---SGEGENSNGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTH 494
            ||..|.|.|   .|.|:|                      |.:|.||:||.:||..|:..|:...
Mosquito   129 DGTTSSEDGLDADGNGKN----------------------KTKRIRTTFTEEQIQILQANFQVDS 171

  Fly   495 YPDVFARERLAGKIGLPEARIQVWFSNRRAKWR------REEKLRNQRRTP-NSTGASATSSSTS 552
            .||....||:|...||.:...||||.|.||:.:      |.:.|.|..|:. |:...::.|||.|
Mosquito   172 NPDGQDLERIALATGLSKRVTQVWFQNSRARQKKHVHVPRAQDLFNGMRSDLNNNNNNSCSSSNS 236

  Fly   553 ATASLTDSP 561
                 .|.|
Mosquito   237 -----NDGP 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 22/51 (43%)
AgaP_AGAP006537XP_001237835.2 LIM1_AWH 8..61 CDD:188759
LIM2_AWH 69..123 CDD:188765
Homeobox 152..204 CDD:278475 22/51 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.