DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and Rhox8

DIOPT Version :10

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_001004193.1 Gene:Rhox8 / 434768 MGIID:3579898 Length:320 Species:Mus musculus


Alignment Length:98 Identity:40/98 - (40%)
Similarity:54/98 - (55%) Gaps:1/98 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   432 LDGHQSDETGSGEGENSNGGASNI-GNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHY 495
            :|....|...|..||:...|...| |.|:..:|......:|.|||..||..|:..||:.|||.||
Mouse   220 VDDRSHDAGASSNGEDRGQGEELIPGGTKGLEALPSPSGQLPRNRYRFTKFQLQELERIFERNHY 284

  Fly   496 PDVFARERLAGKIGLPEARIQVWFSNRRAKWRR 528
            |...||..||..||:.|:|::.||.:||||:|:
Mouse   285 PSAAARRELARWIGVTESRVENWFKSRRAKYRK 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeodomain 473..528 CDD:459649 28/54 (52%)
Rhox8NP_001004193.1 Homeodomain 262..317 CDD:459649 28/54 (52%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.