DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and LHX8

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:XP_016856805.1 Gene:LHX8 / 431707 HGNCID:28838 Length:363 Species:Homo sapiens


Alignment Length:190 Identity:56/190 - (29%)
Similarity:75/190 - (39%) Gaps:58/190 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   444 EGENSNG----GASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERL 504
            |.||.||    ||.   .||.|...   .:..:|.|||||.||:..::.:|.:.:.||....::|
Human   190 EVENGNGISVEGAL---LTEQDVNH---PKPAKRARTSFTADQLQVMQAQFAQDNNPDAQTLQKL 248

  Fly   505 AGKIGLPEARIQVWFSNRRAKWRREEKLRNQRRTPNSTGASATSSSTSATASLTDSPNSLS-ACS 568
            |.:.||....|||||.|.||:.::..       :||.      ||||..||.   .|:.|| ...
Human   249 AERTGLSRRVIQVWFQNCRARHKKHV-------SPNH------SSSTPVTAV---PPSRLSPPML 297

  Fly   569 SLLSGSAGGPSVSTI-------------------------------NGLSSPSTLSTNVN 597
            ..::.||..|...|:                               ||.||.|||....|
Human   298 EEMAYSAYVPQDGTMLTALHSYMDDTHAAVHIHLPGRMWRFQGYSNNGSSSGSTLICKYN 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 22/51 (43%)
LHX8XP_016856805.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.