DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and tin

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster


Alignment Length:430 Identity:94/430 - (21%)
Similarity:155/430 - (36%) Gaps:140/430 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 QKEQQSTGSG------SSSTSAGNSISAKVSVSIGGNVSNVAS---------GSRGTLSSSTDLM 275
            |..||...||      :.|.|.|:..:|....:...:|.::.:         ||.|.:..:.   
  Fly     3 QHHQQQAQSGGYYDHYTQSPSPGSLTNADALNTTPFSVKDILNMVNQTEAYEGSYGHIDGAA--- 64

  Fly   276 QTATPLNSSESGGASN-----SGEGSEQEAIYEKLRLLNTQHAAGPGPLEPARAAPLVGQSPNHL 335
             ||:.|.:  :|...|     :.:..:|..:....:.|:.|| ...|....:..:||:...|:.|
  Fly    65 -TASALFA--AGEYQNPHQYLNHQQHQQSELPIPQQQLHHQH-LDDGATTSSSLSPLLPPPPHQL 125

  Fly   336 -------GTRSSHPQLVHGN-HQALQQHQQQSWPPRHYSGSWYPTSLSEIPISSAPNIASVTAYA 392
                   |..:...|..||: ||:.|           :|.|.|..|.|:....     ||.|||.
  Fly   126 YGGYQDYGMPAHMFQHHHGHPHQSFQ-----------HSASAYNMSASQFYAG-----ASATAYQ 174

  Fly   393 SGPSLAHSLSPPNDI---ESLASIGHQRN-------CPVATEDIHLKKELDGHQSD--------- 438
            :..:..::.:...::   .:.:::|.:..       .|..|.|::...|:|..|:.         
  Fly   175 TPATYNYNYAGSGEVYGGATPSAVGIKSEYIPTPYVTPSPTLDLNSSAEVDSLQAPTQKLCVNPL 239

  Fly   439 -----ET-----------GSGEG-----------------ENSNGGASNIG-NTEDDQARLILKR 469
                 ||           ||.||                 :||..|.||.| |:...:.|  :||
  Fly   240 SQRLMETASNSSSLRSIYGSDEGAKKKDNSQVTSSRSELRKNSISGNSNPGSNSGSTKPR--MKR 302

  Fly   470 KLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREE---- 530
            |   .|..|:..|:..||..|....|.....||.:|.|:.|...::::||.|||.|.:|.:    
  Fly   303 K---PRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQNRRYKSKRGDIDCE 364

  Fly   531 ------KLRNQRRTPNSTGASATSSSTSATASLTDSPNSL 564
                  ||:::.                     .|||.||
  Fly   365 GIAKHLKLKSEP---------------------LDSPTSL 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 18/51 (35%)
tinNP_524433.1 HOX 301..357 CDD:197696 21/58 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I3587
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.