DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and abd-A

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster


Alignment Length:474 Identity:94/474 - (19%)
Similarity:151/474 - (31%) Gaps:175/474 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 STSAGNSISAKVSVSIGGNVSNVASGSRGTLSSSTDLMQTATPLNSSESGGASNSGEGSEQEAIY 302
            :|:..||.||.|:.::....::.::....:.||:.:...|....|:|.:..:|:|...|...   
  Fly    26 TTTPPNSSSAAVAAALAAAAASASASVSASSSSNNNSSNTIAGSNTSNTNNSSSSPSSSSNN--- 87

  Fly   303 EKLRLLNTQHAAGPGPLEPARAAPLVGQSPNHLGTRSS-----HPQL--VHGNHQ---------- 350
                  |:......|.|.|:..:..:||||:...:.||     |||:  .|.|||          
  Fly    88 ------NSNLNLSGGSLSPSHLSQHLGQSPHSPVSSSSPFQQHHPQVQQQHLNHQQQQHLHHQQQ 146

  Fly   351 -----------ALQQHQQQS----------------------WPPRHYSGSWYPTSLSEIPISS- 381
                       |||..|||.                      .||...:.....:|.|..|.:| 
  Fly   147 QHHHQYSSLSAALQLQQQQHHISKLAAAAVASHGHAHQQLLLTPPSAGNSQAGDSSCSPSPSASG 211

  Fly   382 -----------APNIASVTAYASG---------------------------PSLAHSLSPPNDIE 408
                       :|..||.:|.||.                           |.:::..|....:.
  Fly   212 SSSLHRSLNDNSPGSASASASASAASSVAAAAAAAAAAASSSFAIPTSKMYPYVSNHPSSHGGLS 276

  Fly   409 SLASIG--HQRNCPVATEDIHLKKELDGHQS---------------------------------- 437
            .:|...  ..::|...|:.:     ::.:||                                  
  Fly   277 GMAGFTGLEDKSCSRYTDTV-----MNSYQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIG 336

  Fly   438 -DETGSGEGENSNG---GASNIGN------------TEDDQARLILKRKL------------QRN 474
             |..|:...:.::|   ||...|.            |..|......:|.:            :|.
  Fly   337 VDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRG 401

  Fly   475 RTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRRE--------EK 531
            |.::|..|...|||||...||.....|..:|..:.|.|.:|::||.|||.|.::|        |:
  Fly   402 RQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQ 466

  Fly   532 LRNQRRTPNSTGASATSSS 550
            .|..|.......|..|..|
  Fly   467 ARRDREEQEKMKAQETMKS 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 21/51 (41%)
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 21/51 (41%)
Abdominal-A 456..478 CDD:289192 4/21 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.