DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and Poxm

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_001036687.1 Gene:Poxm / 40990 FlyBaseID:FBgn0003129 Length:370 Species:Drosophila melanogaster


Alignment Length:392 Identity:138/392 - (35%)
Similarity:177/392 - (45%) Gaps:113/392 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 DDEC--HSGVNQLGGVFVGGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYET 156
            :.:|  :..|||||||||.|||||::||.:|||||..|.|||||||.|:||:|||||||.||:||
  Fly     4 ESQCPQYGEVNQLGGVFVNGRPLPNATRMRIVELARLGIRPCDISRQLRVSHGCVSKILARYHET 68

  Fly   157 GSIRPRAIGGSKPRVATAEVVSKISQYKRECPSIFAWEIRDRLLQENVCTNDNIPSVSSINRVLR 221
            |||.|.|||||||||.|.:||:.|.:.|:..|.|||||||||||.|.:|...|:||||||:|:||
  Fly    69 GSILPGAIGGSKPRVTTPKVVNYIRELKQRDPGIFAWEIRDRLLSEGICDKTNVPSVSSISRILR 133

  Fly   222 N-LAAQKEQQSTGS--GSSSTSAGNSISAKVSVSIGGNVSNVASGSRGTLSSSTDLMQTATPLNS 283
            | |.:...|.:.|:  ||.|:|.|.|:|                                     
  Fly   134 NKLGSLGHQHTPGTVMGSGSSSGGGSVS------------------------------------- 161

  Fly   284 SESGGASNSGEGSEQEAIYEKLRLLNTQHAAGPGPLEPARAAPLVGQSPNHLGTRSSHPQLVHGN 348
              |.|..|:|..:...        :|..:...||      ..|   ..|:|           |.:
  Fly   162 --SNGGQNNGTSASNN--------INLSNLGNPG------GGP---HHPHH-----------HHH 196

  Fly   349 HQ----ALQQHQQQSWPPRH---YSGSWYPTSLSEIPISSAPNIASVTAYASGPSLAHSLSPPND 406
            ||    |...|...:....|   |:..:.|.|             :..|| |..:...|.|||..
  Fly   197 HQSAAAAASAHHVHAHAHAHAHLYNSIYQPYS-------------AAAAY-SMKTPCGSPSPPQG 247

  Fly   407 IESLASIGHQ---RNCPVATEDIH------LKKELDGHQ------SDETGSGEGENSNGGASNIG 456
            .....|:.|.   |:...|....|      :...|..||      |.:.|.|.     ||...:|
  Fly   248 AGGQGSVPHPHQLRSVAAAAAAAHWPSSHSVSDILAHHQAVALRASCQVGVGV-----GGMGGMG 307

  Fly   457 NT 458
            :|
  Fly   308 ST 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645 83/122 (68%)
Homeobox 475..527 CDD:278475
PoxmNP_001036687.1 PAX 10..133 CDD:128645 83/122 (68%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450837
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.